Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57625 160 / 4e-50 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 159 / 7e-50 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 157 / 5e-49 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 147 / 4e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G30320 144 / 2e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 142 / 1e-42 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 139 / 2e-42 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 137 / 2e-41 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 128 / 4e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 127 / 1e-37 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005557 [exp] 172 / 7e-55 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 170 / 4e-54 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 150 / 5e-46 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 145 / 3e-44 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 145 / 3e-44 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 143 / 8e-44 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 140 / 1e-42 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10012479 [exp] 137 / 3e-41 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 135 / 7e-41 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G007000 [exp] 189 / 1e-61 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 155 / 1e-48 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 145 / 1e-44 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 143 / 5e-44 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 142 / 2e-43 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 141 / 4e-43 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 137 / 1e-40 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083600 [exp] 132 / 8e-40 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 132 / 5e-39 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.009G082800 [exp] 125 / 5e-37 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10011318 pacid=23149926 polypeptide=Lus10011318 locus=Lus10011318.g ID=Lus10011318.BGIv1.0 annot-version=v1.0 ATGACTTCCACCTCAAGTCATCTCCTCTCTTCCATAACCTTATCCACTTTCATCCTCTTCCTCTCCATCTCCCCATCGTCTTCGGCAACGATCCCAAACC CTAGGCGTGCAATGCGTGCCAATCCAGCCATAGTCCAAACCCAACTACTGGATGCTCACAACGCCGTGAGGACAAAGCACAAGCTCCCACCTCTAACGTG GAGCGCTAAGCTAGCGAACTATGCGAAGTGGTACGGGAACCAGAGGAGAAATGACTGCCGCCTGGTACACTCGACAGCAGACTATGGGGAGAACATCTTT TGGGGACAGGGACAGAGCTGGAAGGTGACCGATGCTGTGAAAGGTTGGGCTGTTCAAGAGGGGTACTATAACTACAGGAGCAATAGTTGTATGCCGGGGA AGGATTGCTTGCACTACACGCAATTGGTGTGGAGGAGTACAAAACAAGTTGGATGTGCTAGGGTTAAGTGCCGTAACGGTGATACTTATGTTGTTTGCGA GTATTACCCCCATGGCAATGTTATTGGAGAGAAGCCCTACTAG
AA sequence Show only first row Show all	>Lus10011318 pacid=23149926 polypeptide=Lus10011318 locus=Lus10011318.g ID=Lus10011318.BGIv1.0 annot-version=v1.0 MTSTSSHLLSSITLSTFILFLSISPSSSATIPNPRRAMRANPAIVQTQLLDAHNAVRTKHKLPPLTWSAKLANYAKWYGNQRRNDCRLVHSTADYGENIF WGQGQSWKVTDAVKGWAVQEGYYNYRSNSCMPGKDCLHYTQLVWRSTKQVGCARVKCRNGDTYVVCEYYPHGNVIGEKPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31470			CAP (Cysteine-rich secretory p...		Lus10011318 [exp]	0	1
AT2G47270	bHLH	bHLH151, UPB1	UPBEAT1, sequence-specific DNA...		Lus10010001 [exp]	3.5	0.9759
AT2G43870			Pectin lyase-like superfamily ...		Lus10022530 [exp]	3.7	0.9771
AT5G54370			Late embryogenesis abundant (L...		Lus10026972 [exp]	4.0	0.9761
AT3G14470			NB-ARC domain-containing disea...		Lus10002609 [exp]	6.6	0.9748
AT5G51480		SKS2	SKU5 similar 2 (.1)		Lus10038920 [exp]	8.0	0.9669
AT3G20820			Leucine-rich repeat (LRR) fami...		Lus10002551 [exp]	9.2	0.9740
AT4G12730		FLA2	FASCICLIN-like arabinogalactan...		Lus10001752 [exp]	9.5	0.9738
AT5G54370			Late embryogenesis abundant (L...		Lus10017577 [exp]	10.7	0.9738
AT4G37160		SKS15	SKU5 similar 15 (.1)		Lus10019642 [exp]	11.0	0.9733
					Lus10023996 [exp]	11.4	0.9282

Compare expression of checked genes

Lus10011318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.