Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52105 72 / 1e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012208 [exp] 126 / 2e-40 AT3G52105 70 / 5e-18 unknown protein Lus10042363 [exp] 97 / 1e-28 AT3G52105 75 / 6e-20 unknown protein Lus10026305 [exp] 97 / 2e-25 AT3G57570 229 / 2e-65 ARM repeat superfamily protein (.1.2) Lus10029521 [exp] 84 / 2e-23 AT3G52105 85 / 8e-24 unknown protein Lus10016415 [exp] 75 / 7e-20 AT3G52105 81 / 3e-22 unknown protein Lus10019704 [exp] 75 / 1e-19 AT3G52105 80 / 6e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G053400 [exp] 96 / 1e-27 AT3G52105 76 / 9e-20 unknown protein Potri.001G267501 [exp] 86 / 5e-24 AT3G52105 87 / 9e-25 unknown protein Potri.006G054200 [exp] 85 / 6e-24 AT3G52105 67 / 2e-16 unknown protein Potri.009G061800 [exp] 84 / 1e-23 AT3G52105 90 / 1e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011321 pacid=23149896 polypeptide=Lus10011321 locus=Lus10011321.g ID=Lus10011321.BGIv1.0 annot-version=v1.0 ATGTTGCAACTATTCTTCGCGGTTGCCATATCGGCGGTTCCGCTAACCCTGTACATACCGCCGATCCGCTCCCTGAACCTGTTCGTCGAGACGACCGAGG ATTTGCTCCGTCAGATGGCTTTCCACACGATCAGGACTTATCCTCGCATACGATTCGCCTTCTCTCGCATCCTCAACAGCCTCATCCGCCTCGCCAGGTA A
AA sequence Show only first row Show all	>Lus10011321 pacid=23149896 polypeptide=Lus10011321 locus=Lus10011321.g ID=Lus10011321.BGIv1.0 annot-version=v1.0 MLQLFFAVAISAVPLTLYIPPIRSLNLFVETTEDLLRQMAFHTIRTYPRIRFAFSRILNSLIRLAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52105			unknown protein		Lus10011321 [exp]	0	1
AT3G09770		LOG2	LOSS OF GDU 2, RING/U-box supe...		Lus10023182 [exp]	1.0	0.9196
AT1G16840			unknown protein		Lus10035733 [exp]	1.7	0.8882
AT2G45040			Matrixin family protein (.1)		Lus10028180 [exp]	4.9	0.8889
AT3G63220			Galactose oxidase/kelch repeat...		Lus10042607 [exp]	6.6	0.8606
AT5G40470			RNI-like superfamily protein (...		Lus10002515 [exp]	6.7	0.8520
AT5G35090			unknown protein		Lus10019575 [exp]	7.2	0.8318
AT3G03440			ARM repeat superfamily protein...		Lus10033593 [exp]	7.7	0.8363
AT4G16400			unknown protein		Lus10016614 [exp]	9.8	0.8194
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10041353 [exp]	9.9	0.8474
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10032223 [exp]	14.4	0.8439

Compare expression of checked genes

Lus10011321 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.