Lus10011332 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50760 98 / 3e-26 SAUR-like auxin-responsive protein family (.1)
AT5G20810 72 / 2e-16 SAUR-like auxin-responsive protein family (.1.2)
AT3G20220 69 / 2e-15 SAUR-like auxin-responsive protein family (.1)
AT3G43120 68 / 7e-15 SAUR-like auxin-responsive protein family (.1)
AT3G20210 70 / 2e-14 DELTAVPE, DELTA-VPE delta vacuolar processing enzyme (.1.2)
AT3G12830 66 / 2e-14 SAUR-like auxin-responsive protein family (.1)
AT2G24400 67 / 3e-14 SAUR-like auxin-responsive protein family (.1)
AT1G56150 65 / 4e-14 SAUR-like auxin-responsive protein family (.1)
AT3G61900 66 / 5e-14 SAUR-like auxin-responsive protein family (.1)
AT5G10990 66 / 8e-14 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003140 318 / 3e-113 AT5G50760 97 / 8e-26 SAUR-like auxin-responsive protein family (.1)
Lus10034888 68 / 1e-14 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
Lus10034507 67 / 3e-14 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10026977 65 / 3e-13 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10012426 64 / 3e-13 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10012185 63 / 3e-13 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Lus10042374 63 / 5e-13 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026297 63 / 5e-13 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10033161 63 / 6e-13 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G167400 145 / 5e-45 AT5G50760 100 / 4e-27 SAUR-like auxin-responsive protein family (.1)
Potri.001G060400 134 / 7e-40 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Potri.012G102700 111 / 2e-31 AT5G50760 97 / 1e-25 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 72 / 2e-16 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 70 / 9e-16 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.006G137200 71 / 2e-15 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2)
Potri.006G278100 68 / 1e-14 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.008G003900 67 / 2e-14 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Potri.018G063400 67 / 2e-14 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.009G127100 66 / 2e-14 AT5G18080 103 / 2e-30 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10011332 pacid=23159256 polypeptide=Lus10011332 locus=Lus10011332.g ID=Lus10011332.BGIv1.0 annot-version=v1.0
ATGGATCAACCCAAGAAAAAGGGCAATCTAATCAGCAAGACGTGGGAGAAGTCATGCAAGCTCCTCCTCCTCCGCAAGAGGCCCTCGAGGACGGGCAGCT
TCTACACCGACGACGGCGAAGATCCAAAACGGCGCCGTCATGGTAAGCGCCAGGTGGCACCGGAAGGGTGCTTCACGGTGTACGTGGGGCCAGAGAAGCA
GAGGTTTGTGGTGATGACAGAGTACGCTAACCACCCGATGTTCCGGGTCCTGCTGGACGAGGCGGAGTCGGAGTTCGGGTACAACCCGGAAGGCCCGCTG
GTGCTTCCTTGCGAGGTTGACTACTTCTGGAAAGTTCTGATGGATATGGACAGTGAAGTTGAAGAAGAGGCGGCGGAGAAGGAAGAGCTTGTTCATCAGA
AGTCGTGTGGACGGTTTGCTAAGGCGGCTGGCAGTTATAACGGTTCTTATTACCATCGTCATCTCATCTGCCCGTCGCCGTTGATGGCTCTCAACCGTTA
CGTCATATGA
AA sequence
>Lus10011332 pacid=23159256 polypeptide=Lus10011332 locus=Lus10011332.g ID=Lus10011332.BGIv1.0 annot-version=v1.0
MDQPKKKGNLISKTWEKSCKLLLLRKRPSRTGSFYTDDGEDPKRRRHGKRQVAPEGCFTVYVGPEKQRFVVMTEYANHPMFRVLLDEAESEFGYNPEGPL
VLPCEVDYFWKVLMDMDSEVEEEAAEKEELVHQKSCGRFAKAAGSYNGSYYHRHLICPSPLMALNRYVI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G50760 SAUR-like auxin-responsive pro... Lus10011332 0 1
AT5G43200 Zinc finger, C3HC4 type (RING ... Lus10019685 1.4 0.9360
AT3G06240 F-box family protein (.1) Lus10014793 2.4 0.9385
AT4G39090 EMB3005, RD19A,... RESPONSIVE TO DEHYDRATION 19A,... Lus10017487 4.5 0.9236
AT3G19000 2-oxoglutarate (2OG) and Fe(II... Lus10020999 5.1 0.9032
AT5G09620 Octicosapeptide/Phox/Bem1p fam... Lus10035641 5.3 0.9029
AT4G39090 EMB3005, RD19A,... RESPONSIVE TO DEHYDRATION 19A,... Lus10017489 5.5 0.9236
AT5G50120 Transducin/WD40 repeat-like su... Lus10043466 6.5 0.8962
AT5G45920 SGNH hydrolase-type esterase s... Lus10013941 7.5 0.9206
AT5G03380 Heavy metal transport/detoxifi... Lus10023924 11.1 0.9248
AT5G17530 phosphoglucosamine mutase fami... Lus10023518 13.2 0.8756

Lus10011332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.