Lus10011333 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14070 151 / 9e-48 ROXY2 Thioredoxin superfamily protein (.1)
AT3G02000 144 / 7e-45 ROXY1 Thioredoxin superfamily protein (.1)
AT3G21460 114 / 1e-33 Glutaredoxin family protein (.1)
AT5G18600 110 / 4e-32 Thioredoxin superfamily protein (.1)
AT4G15670 108 / 2e-31 Thioredoxin superfamily protein (.1)
AT4G15700 108 / 2e-31 Thioredoxin superfamily protein (.1)
AT3G62950 108 / 2e-31 Thioredoxin superfamily protein (.1)
AT4G15680 108 / 4e-31 Thioredoxin superfamily protein (.1)
AT4G15660 107 / 5e-31 Thioredoxin superfamily protein (.1)
AT4G15690 106 / 1e-30 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003141 207 / 8e-70 AT5G14070 84 / 2e-21 Thioredoxin superfamily protein (.1)
Lus10035183 146 / 9e-46 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10041538 136 / 8e-42 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10012815 121 / 2e-36 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1)
Lus10033965 120 / 8e-36 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Lus10002887 117 / 6e-35 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1)
Lus10038514 112 / 3e-32 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Lus10023295 109 / 3e-31 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Lus10040899 100 / 3e-28 AT2G30540 140 / 5e-45 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G325800 176 / 9e-58 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.001G060600 172 / 2e-56 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.003G167000 171 / 8e-56 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.008G214500 122 / 1e-36 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.010G021800 116 / 2e-34 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.008G214800 109 / 1e-31 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
Potri.008G214600 108 / 2e-31 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
Potri.002G208400 103 / 1e-29 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1)
Potri.014G134300 99 / 1e-27 AT2G30540 157 / 1e-51 Thioredoxin superfamily protein (.1)
Potri.004G049800 97 / 3e-26 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10011333 pacid=23159225 polypeptide=Lus10011333 locus=Lus10011333.g ID=Lus10011333.BGIv1.0 annot-version=v1.0
ATGTATACGCAGCAGTACTACCCTGACCTTCACCATTATCGCTACAACCCCTCCTCGGACCACCACCATCATCATCAGATGCAGCAGCCAGCATACTACG
GCGGAGTTGCCCCGGCAGTGCCGGACCCGCTGGAGAAGGTGGCGAGGCTGGCGGCCGAGAGCGCGGTGGTGATATTCAGCCTCAGCACGTGCTGCATGTG
CCATGCTGTCAAGCGACTCTTCTGCAGCATGGGAGTCAGCCCCAACGTGATAGAGCTCGACAACCACCCACGTGGCAGGGAGTTTGAACGCGCATTGCTA
CGCCTACACGTCGTTGCCAATACTACAAGCTACGGCGGCACGTCGTCATCCGCCGTTCCATTGGTGTTCATCGGCGGGAAGCTTATCGGAGCGATGGATA
GGGTCATGGCTTCCCACATTAACGGCACTCTCGTCCCGCTCCTTAAGGAAGCCGGCGCTCTTTGGCTCTAG
AA sequence
>Lus10011333 pacid=23159225 polypeptide=Lus10011333 locus=Lus10011333.g ID=Lus10011333.BGIv1.0 annot-version=v1.0
MYTQQYYPDLHHYRYNPSSDHHHHHQMQQPAYYGGVAPAVPDPLEKVARLAAESAVVIFSLSTCCMCHAVKRLFCSMGVSPNVIELDNHPRGREFERALL
RLHVVANTTSYGGTSSSAVPLVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10011333 0 1
Lus10007549 2.8 0.9890
AT3G05600 alpha/beta-Hydrolases superfam... Lus10029878 3.3 0.9902
AT5G63090 AS2 LOBB, LOB Lateral organ boundaries (LOB)... Lus10011906 4.2 0.9893
AT1G65870 Disease resistance-responsive ... Lus10016231 4.5 0.9898
AT1G71691 GDSL-like Lipase/Acylhydrolase... Lus10009457 4.5 0.9858
AT3G26120 TEL1 terminal EAR1-like 1 (.1) Lus10002046 5.0 0.9887
AT5G01660 unknown protein Lus10018307 6.9 0.9880
Lus10041871 8.4 0.9876
Lus10016534 8.8 0.9839
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10003141 9.0 0.9744

Lus10011333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.