Lus10011339 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003135 130 / 9e-42 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G102100 46 / 3e-08 ND /
PFAM info
Representative CDS sequence
>Lus10011339 pacid=23159221 polypeptide=Lus10011339 locus=Lus10011339.g ID=Lus10011339.BGIv1.0 annot-version=v1.0
ATGAAGGGTAGAGGAGCTATGCCAAGTGTTGTGGAGATTCTACTGTTTGTTGTGGTATTCATGGCTATGAATGCTTTGAGAGGTGAAGCAGTGTTTGGGA
TAGACATGAACCCTTGCACACTCGTAAGCTGCACAGATGCCTGCAAGAATCTTCTTGGGGATAAGTTTGACAGTGCATCTTGCTACCAAGGAATCATCTG
TATGTGCTTTGGTTGA
AA sequence
>Lus10011339 pacid=23159221 polypeptide=Lus10011339 locus=Lus10011339.g ID=Lus10011339.BGIv1.0 annot-version=v1.0
MKGRGAMPSVVEILLFVVVFMAMNALRGEAVFGIDMNPCTLVSCTDACKNLLGDKFDSASCYQGIICMCFG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011339 0 1
Lus10003135 1.0 0.9700
AT5G35732 unknown protein Lus10006404 2.0 0.9054
AT1G18590 SOT17, ATSOT17,... ARABIDOPSIS SULFOTRANSFERASE 5... Lus10017878 3.5 0.8960
AT2G39770 VTC1, SOZ1, GMP... VITAMIN C DEFECTIVE 1, SENSITI... Lus10010880 4.7 0.8730
AT5G47810 PFK2 phosphofructokinase 2 (.1) Lus10039992 5.2 0.8526
AT4G20880 ethylene-responsive nuclear pr... Lus10023347 5.5 0.9025
AT1G47410 unknown protein Lus10006481 7.4 0.8928
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10016497 8.9 0.8575
AT1G78380 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. ... Lus10026198 9.0 0.8762
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10023213 10.6 0.8792

Lus10011339 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.