Lus10011351 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003122 102 / 3e-29 AT5G65070 65 / 5e-13 MADS AFFECTING FLOWERING 4, AGAMOUS-like 69, K-box region and MADS-box transcription factor family protein (.1.2.3)
Lus10037038 57 / 1e-11 AT5G65060 52 / 1e-08 MADS AFFECTING FLOWERING 3, AGAMOUS-like 70, K-box region and MADS-box transcription factor family protein (.1.2)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011351 pacid=23159191 polypeptide=Lus10011351 locus=Lus10011351.g ID=Lus10011351.BGIv1.0 annot-version=v1.0
ATGGAAAATGAAGAGATAAATTACTCACAGGTTTGGTTTTTGCAGATGCAACTGATGTTGGAACCCTTACAAACACTGCAACAACAGGAGAACAAGCTAA
GACAGGAAAACGAGCAGTTGAAAGAACAGATAGCTGCAGCCTCAGCCGCGGCGAAGAATGATAGCAACACTGTCTTAGGCACCATCAAAGGCACGGATCA
GCAAAGTGGCTTGGTACAGCCGGCCACTCTGCAATTACTCCATTTGATGTAG
AA sequence
>Lus10011351 pacid=23159191 polypeptide=Lus10011351 locus=Lus10011351.g ID=Lus10011351.BGIv1.0 annot-version=v1.0
MENEEINYSQVWFLQMQLMLEPLQTLQQQENKLRQENEQLKEQIAAASAAAKNDSNTVLGTIKGTDQQSGLVQPATLQLLHLM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011351 0 1
AT5G27420 CNI1, ATL31 carbon/nitrogen insensitive 1 ... Lus10043034 4.5 0.8210
AT1G47270 TUB AtTLP6 tubby like protein 6 (.1.2) Lus10010645 8.7 0.8136
AT1G35420 alpha/beta-Hydrolases superfam... Lus10000375 9.6 0.8102
AT5G61820 unknown protein Lus10033851 11.3 0.8158
Lus10034297 13.9 0.7951
AT1G34370 C2H2ZnF STOP1 sensitive to proton rhizotoxic... Lus10011495 14.3 0.8057
AT5G03680 Trihelix PTL PETAL LOSS, Duplicated homeodo... Lus10027718 15.2 0.7813
AT4G03600 unknown protein Lus10039834 19.4 0.8061
AT2G40200 bHLH bHLH051 basic helix-loop-helix (bHLH) ... Lus10028978 20.5 0.8042
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10026597 21.5 0.7777

Lus10011351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.