Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27330 78 / 4e-21 Ribosome associated membrane protein RAMP4 (.1) AT1G27350 78 / 4e-21 Ribosome associated membrane protein RAMP4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037031 [exp] 84 / 3e-23 AT1G27350 120 / 6e-38 Ribosome associated membrane protein RAMP4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G017100 [exp] 76 / 2e-20 AT1G27330 119 / 2e-37 Ribosome associated membrane protein RAMP4 (.1) Potri.003G171100 [exp] 73 / 4e-19 AT1G27330 121 / 3e-38 Ribosome associated membrane protein RAMP4 (.1) Potri.001G057300 [exp] 70 / 5e-18 AT1G27330 116 / 3e-36 Ribosome associated membrane protein RAMP4 (.1) Potri.016G008600 [exp] 64 / 2e-15 AT1G27330 72 / 2e-18 Ribosome associated membrane protein RAMP4 (.1) Potri.001G057150 [exp] 59 / 1e-13 AT1G27330 99 / 4e-29 Ribosome associated membrane protein RAMP4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06624 [flax] [poplar] RAMP4 Ribosome associated membrane protein RAMP4
Representative CDS sequence Show only first row Show all	>Lus10011355 pacid=23159223 polypeptide=Lus10011355 locus=Lus10011355.g ID=Lus10011355.BGIv1.0 annot-version=v1.0 ATGGATAATACTACGTCAAAGAGGCTTGCGGATAGGAAGATATCCAAATTCCAGAAGAACATTACAAAGAGAGGAGCTGTTCCTGATACAAACACAGAGA AGAAGGATTACCCCGTCGGCCCTTTCCTCCTCGGATTCTTCGTCTTCGTCGTCATCGGATCATCTCTGTTCCAGATTATCAGGACGGCAACAAGCGGACG CATGGCTTAA
AA sequence Show only first row Show all	>Lus10011355 pacid=23159223 polypeptide=Lus10011355 locus=Lus10011355.g ID=Lus10011355.BGIv1.0 annot-version=v1.0 MDNTTSKRLADRKISKFQKNITKRGAVPDTNTEKKDYPVGPFLLGFFVFVVIGSSLFQIIRTATSGRMA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27350			Ribosome associated membrane p...		Lus10011355 [exp]	0	1
AT2G01690			ARM repeat superfamily protein...		Lus10001587 [exp]	2.8	0.8243
AT5G27260			unknown protein		Lus10010798 [exp]	4.2	0.7610
AT2G47980		SCC3, ATSCC3	sister-chromatid cohesion prot...		Lus10023798 [exp]	10.6	0.7772
AT4G33240		FAB1A	FORMS APLOID AND BINUCLEATE CE...		Lus10038127 [exp]	12.7	0.8076
AT2G28320			Pleckstrin homology (PH) and l...		Lus10016094 [exp]	16.7	0.7655
AT1G71240			Plant protein of unknown funct...		Lus10002408 [exp]	18.5	0.8005
AT3G06580		GAL1, GALK	GALACTOSE KINASE 1, Mevalonate...		Lus10016321 [exp]	19.7	0.7438
AT3G49060			U-box domain-containing protei...		Lus10039245 [exp]	21.4	0.7294
					Lus10024939 [exp]	23.7	0.7510
AT5G49610			F-box family protein (.1)		Lus10037619 [exp]	24.4	0.6089

Compare expression of checked genes

Lus10011355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.