Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27950 102 / 1e-27 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) AT3G22600 51 / 3e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 50 / 9e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 49 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 47 / 9e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 45 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G14815 44 / 7e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 42 / 3e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G05960 41 / 3e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 42 / 4e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006413 [exp] 200 / 3e-66 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10037027 [exp] 135 / 6e-41 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10015779 [exp] 135 / 8e-41 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10033076 [exp] 57 / 2e-10 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 56 / 4e-10 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017749 [exp] 55 / 2e-09 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 53 / 7e-09 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 52 / 2e-08 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 52 / 2e-08 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G056200 [exp] 119 / 2e-34 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.003G172400 [exp] 111 / 3e-31 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.008G155100 [exp] 57 / 2e-10 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 56 / 5e-10 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 50 / 9e-08 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 50 / 9e-08 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 48 / 3e-07 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G196300 [exp] 42 / 1e-05 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G104300 [exp] 41 / 6e-05 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G211800 [exp] 40 / 0.0001 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10011358 pacid=23159243 polypeptide=Lus10011358 locus=Lus10011358.g ID=Lus10011358.BGIv1.0 annot-version=v1.0 ATGTCTCCCCTCATATATGATCCAAAACATTACAATTTCAACCATCTCTCACAACCCATCATATCAAACATGAAAGCCACTACTTTTCTTCTCCTCATCT CCCTCTCTTTCGCCGCCGCCGCCGTCGCCCACGAAGGCTCCAACGACAATCTGGCGAAGGACTGCAGCAAGGAGATCCAAGGAGTGATGCCATGCTTGGC CTTTGCACAAGGGAAGCAAGCTTCGCCTTCGAAAGAGTGCTGTGACAACACAAAGGCCACCAAGGAGAACAAACCCAAGTGCTTGTGTTACATCATGATG CAGACTCACAACGGCGGGTCTCAGTTCAGGAGCCTCGGTGTGCAGGAGGCTAAGTTGATTCAGCTCCCTACCACCTGCCAGCTCGCTAACGCTAGCGTTA GCTATTGCCCAGGTTCGTCGAGAAAAGTCGAAAGAACCCGAATAGAAATGCACCGAGTAGGAATGTATAGGGGAAAATGGACTTAG
AA sequence Show only first row Show all	>Lus10011358 pacid=23159243 polypeptide=Lus10011358 locus=Lus10011358.g ID=Lus10011358.BGIv1.0 annot-version=v1.0 MSPLIYDPKHYNFNHLSQPIISNMKATTFLLLISLSFAAAAVAHEGSNDNLAKDCSKEIQGVMPCLAFAQGKQASPSKECCDNTKATKENKPKCLCYIMM QTHNGGSQFRSLGVQEAKLIQLPTTCQLANASVSYCPGSSRKVERTRIEMHRVGMYRGKWT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10011358 [exp]	0	1
AT3G16370			GDSL-like Lipase/Acylhydrolase...		Lus10037598 [exp]	1.7	0.9530
AT4G36250		ALDH3F1	aldehyde dehydrogenase 3F1 (.1...		Lus10041806 [exp]	2.0	0.9447
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10006894 [exp]	2.6	0.8968
AT1G09310			Protein of unknown function, D...		Lus10039866 [exp]	3.0	0.9211
AT5G12470			Protein of unknown function (D...		Lus10016379 [exp]	3.7	0.8728
AT3G12080		EMB2738	embryo defective 2738, GTP-bin...		Lus10002557 [exp]	4.5	0.9156
AT3G47600	MYB	ATMYB94, AtMYBC...	myb domain protein 94 (.1)		Lus10008616 [exp]	5.5	0.8920
AT3G24503		ALDH1A, REF1, A...	REDUCED EPIDERMAL FLUORESCENCE...		Lus10023626 [exp]	5.5	0.9093
AT4G12110		ATSMO1-1, SMO1-...	sterol-4alpha-methyl oxidase 1...		Lus10004321 [exp]	6.2	0.8748
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10016680 [exp]	6.7	0.8724

Compare expression of checked genes

Lus10011358 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.