Lus10011363 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27080 151 / 4e-46 TOM20-3 translocase of outer membrane 20 kDa subunit 3 (.1)
AT5G40930 144 / 9e-44 TOM20-4 translocase of outer membrane 20-4 (.1)
AT1G27390 143 / 5e-43 TOM20-2 translocase outer membrane 20-2 (.1)
AT3G27070 114 / 5e-32 TOM20-1 translocase outer membrane 20-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006419 316 / 3e-111 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10012532 151 / 3e-42 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3)
Lus10035211 134 / 7e-39 AT3G27080 210 / 1e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10032045 130 / 1e-37 AT3G27080 211 / 2e-69 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10041558 68 / 3e-14 AT3G27080 83 / 5e-20 translocase of outer membrane 20 kDa subunit 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G330200 167 / 1e-52 AT1G27390 215 / 3e-71 translocase outer membrane 20-2 (.1)
Potri.001G054900 164 / 2e-51 AT1G27390 230 / 4e-77 translocase outer membrane 20-2 (.1)
Potri.003G173400 159 / 2e-49 AT3G27080 208 / 2e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20
Representative CDS sequence
>Lus10011363 pacid=23159197 polypeptide=Lus10011363 locus=Lus10011363.g ID=Lus10011363.BGIv1.0 annot-version=v1.0
ATGGAGTTCACTCAAGAAGACTTCGATCGCCTCCTGTTCATGGAGCACGCCCGACAGACCGCCGAATCCAGCTACGCCAAGGACCCTAAAAACGCCGATA
ACTTGACCAAGTGGGGAGCCGCGTTGCTTCAGCTGTCTCAATTGGAGAAAGGCCCTGCCGCAGTCACTCAGATGCTTGATGAGGCGGTGTTGAGATTCGA
GGAGGCGTTGGGGATAAATCCACGCAAGCATGAAGCTTTGTGGGGGATGGGGAACGCGAACACGAATTATGCATTTTTATCTCCTGATCAAGCTGAAGCA
GGACAACGATTTCATATGGCTGCTGAGTTTTATCAGCGAGCTCTCGACGAAGCTCCGGATAATCCGATATATCGCCAGTCTTTGATGGAGGTTGCTAAGG
CGCCGGAGCTGCATCGACAGGCTTTTGAACAGATGGCTGCGGCTGCAACATCTAAGGGTTCGAAGAAGAAGAAGAGTAGGAAGACTGAGGATTTGATGTA
TGACGTCTGTGGTTGGGTTATACTTGCCGCCGGAGTTGCCGCCATAGTGTCAATCTCAGTGTCAAAGTCCTATAATCACCCCCCGCCACCACCTCCGTCT
TCACATTTCTAA
AA sequence
>Lus10011363 pacid=23159197 polypeptide=Lus10011363 locus=Lus10011363.g ID=Lus10011363.BGIv1.0 annot-version=v1.0
MEFTQEDFDRLLFMEHARQTAESSYAKDPKNADNLTKWGAALLQLSQLEKGPAAVTQMLDEAVLRFEEALGINPRKHEALWGMGNANTNYAFLSPDQAEA
GQRFHMAAEFYQRALDEAPDNPIYRQSLMEVAKAPELHRQAFEQMAAAATSKGSKKKKSRKTEDLMYDVCGWVILAAGVAAIVSISVSKSYNHPPPPPPS
SHF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10011363 0 1
AT4G17310 unknown protein Lus10007477 2.4 0.7415
AT1G15810 S15/NS1, RNA-binding protein (... Lus10010090 3.0 0.7058
AT2G42450 alpha/beta-Hydrolases superfam... Lus10024878 9.8 0.6912
AT1G28610 GDSL-like Lipase/Acylhydrolase... Lus10010208 13.1 0.6967
AT3G15650 alpha/beta-Hydrolases superfam... Lus10002034 16.9 0.7220
AT5G24318 O-Glycosyl hydrolases family 1... Lus10005459 24.2 0.6915
AT3G11640 unknown protein Lus10000027 42.7 0.6583
AT5G65070 MADS FCL4, MAF4, AGL... MADS AFFECTING FLOWERING 4, AG... Lus10003122 53.0 0.6556
Lus10024691 57.8 0.6535
AT4G15010 Mitochondrial substrate carrie... Lus10001980 70.6 0.6092

Lus10011363 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.