Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G40042 75 / 3e-19 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) AT2G22425 70 / 3e-17 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006422 [exp] 103 / 5e-31 AT4G40042 66 / 1e-15 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10037014 [exp] 87 / 3e-24 AT4G40042 131 / 2e-41 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10015793 [exp] 84 / 1e-22 AT4G40042 127 / 2e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10037011 [exp] 82 / 3e-22 AT4G40042 127 / 1e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G175775 [exp] 85 / 2e-23 AT2G22425 124 / 1e-38 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2) Potri.010G059300 [exp] 78 / 1e-20 AT4G40042 119 / 7e-37 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06645 [flax] [poplar] SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12)
Representative CDS sequence Show only first row Show all	>Lus10011365 pacid=23159259 polypeptide=Lus10011365 locus=Lus10011365.g ID=Lus10011365.BGIv1.0 annot-version=v1.0 ATGGACTGGCAAGGACAGAAGCTATCCGTGCGGCTGCTGCAGCTGATGCTCTTCGCCTTCGCGGTAATGGCGGTCTTCACAGGCTACATCATGGGATCGT TTCACACAGTGTTCTTGATCTACGGCGGCGGACTCTTCCTCTCCGCCTTGATACTCCTTCCCAACTGGCCTTTCTCCAACCGCCACTCTCTCCCTTCCGG AAATCAACCGCCGCAGCCTCCCGCCGCCGCTCGCGCCAAACAAAGCTAA
AA sequence Show only first row Show all	>Lus10011365 pacid=23159259 polypeptide=Lus10011365 locus=Lus10011365.g ID=Lus10011365.BGIv1.0 annot-version=v1.0 MDWQGQKLSVRLLQLMLFAFAVMAVFTGYIMGSFHTVFLIYGGGLFLSALILLPNWPFSNRHSLPSGNQPPQPPAAARAKQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G40042			Microsomal signal peptidase 12...		Lus10011365 [exp]	0	1
AT4G38100			unknown protein		Lus10002647 [exp]	1.0	0.8980
AT3G13110		SAT-M, SAT-A, S...	SERINE ACETYLTRANSFERASE 3, SE...		Lus10040503 [exp]	4.9	0.8458
AT3G09650		CRM3, HCF152	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10015059 [exp]	6.6	0.8455
AT3G18490			Eukaryotic aspartyl protease f...		Lus10042978 [exp]	6.9	0.8599
AT4G08150	HD	BP1, KNAT1	BREVIPEDICELLUS 1, BREVIPEDICE...		Lus10028244 [exp]	12.2	0.8172
AT4G11350			Protein of unknown function (D...		Lus10036382 [exp]	12.4	0.8396
AT2G16770	bZIP	bZIP23	Basic-leucine zipper (bZIP) tr...		Lus10027847 [exp]	18.4	0.8021
AT5G17780			alpha/beta-Hydrolases superfam...		Lus10013629 [exp]	18.7	0.8332
AT5G67210		IRX15-L	IRX15-LIKE, Protein of unknown...		Lus10027879 [exp]	21.4	0.8243
AT4G37660			Ribosomal protein L12/ ATP-dep...		Lus10023839 [exp]	24.2	0.7814

Compare expression of checked genes

Lus10011365 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.