Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006424 [exp] 186 / 8e-63 ND / Lus10037007 [exp] 108 / 8e-32 ND / Lus10015798 [exp] 106 / 3e-31 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G058400 [exp] 102 / 7e-29 ND / Potri.008G176700 [exp] 80 / 3e-20 ND / Potri.010G058600 [exp] 56 / 4e-11 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011367 pacid=23159209 polypeptide=Lus10011367 locus=Lus10011367.g ID=Lus10011367.BGIv1.0 annot-version=v1.0 ATGGAGTATGAAAAAGAACCAGTTGTAGTTCGGGCCAAGAGCTTCCGCAACGAGGACTACAACAACAGGAGGGTGTTCCTCAGGAGCTACCCTCTTCACT GGGAATCCGTAGATCGGAGCGATGAAGACATGATCATCCGGCAGCCTACCGACAAGATCAGCAGCAGCCAGAAGAGACCTATGAGGAAGATGATTGTGTC CATGTTTCAGTGGGGGGAAGGGAGGGTTCTGGTCCTGAGGAGGTTCAAGCATAAGGTTTCGGTTTACGTCGTGAGTTGTATACCGATTTCTGGGTACAGG AGTTCTTCTGGGGTTATGATTTCGGGTTGA
AA sequence Show only first row Show all	>Lus10011367 pacid=23159209 polypeptide=Lus10011367 locus=Lus10011367.g ID=Lus10011367.BGIv1.0 annot-version=v1.0 MEYEKEPVVVRAKSFRNEDYNNRRVFLRSYPLHWESVDRSDEDMIIRQPTDKISSSQKRPMRKMIVSMFQWGEGRVLVLRRFKHKVSVYVVSCIPISGYR SSSGVMISG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011367 [exp]	0	1
AT5G67480		ATBT4, BT4	BTB and TAZ domain protein 4 (...		Lus10025196 [exp]	1.7	0.8105
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10024620 [exp]	8.0	0.6475
					Lus10016420 [exp]	23.2	0.6534
AT3G13130			unknown protein		Lus10039066 [exp]	23.2	0.6728
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000072 [exp]	26.7	0.6040
AT1G19900			glyoxal oxidase-related protei...		Lus10012387 [exp]	29.1	0.6332
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000071 [exp]	30.5	0.5950
AT3G47110			Leucine-rich repeat protein ki...		Lus10038688 [exp]	34.9	0.5649
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10029839 [exp]	35.2	0.5925
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10000502 [exp]	35.6	0.6318

Compare expression of checked genes

Lus10011367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.