Lus10011373 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67600 241 / 7e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 234 / 5e-80 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G21610 190 / 2e-62 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT3G61770 127 / 2e-36 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 89 / 4e-22 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006432 310 / 6e-110 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 216 / 2e-73 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10035299 184 / 6e-60 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10000883 179 / 5e-58 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10003670 178 / 2e-57 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030025 169 / 3e-53 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030253 127 / 6e-38 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001756 74 / 4e-16 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001841 74 / 5e-16 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G056600 263 / 3e-91 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.011G087100 194 / 4e-64 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.014G156000 178 / 1e-57 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 172 / 1e-55 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G171300 135 / 2e-39 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 67 / 1e-13 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Lus10011373 pacid=23159219 polypeptide=Lus10011373 locus=Lus10011373.g ID=Lus10011373.BGIv1.0 annot-version=v1.0
ATGGGGGATCAGACCACCGGTGGGTCTTCTTATTCTTCGTCGTCGTCGATTTTCACTAACTATCCTCTGATAGCTGCACTCGTCGCGTTCGCCGTCGCGC
AATCTATCAAGTTCTTCACCACCTGGTACAAAGAAAATCGATGGGATTTGAAGCAGTTCATTGGATCCGGTGGAATGCCTTCTTCCCATTCGTCCACTGT
TTGTGCACTTGCCATGAGCATCGGGTTCCAGGAAGGCTTCGGAGGATCACTTTTCGCGGCTGCGTTGATCTTATCATGCATTGTGATGTATGATGCTACT
GGTGTAAGACTTCAGGCTGGACGCCAAGCCGAGGTATTGAATCAAATTGTATACGAACTGCCTGCTGAACATCCTTTGGCTGAGAGCATACCTCTTCGCG
AGCTTCTCGGTCACACTCCAGCTCAGGTCATCGCCGGTAGTCTACTTGGAGTTGTAACGGCTATCATTGGCCACCTGATCACAATGACTACTAGTCAAAG
TTGA
AA sequence
>Lus10011373 pacid=23159219 polypeptide=Lus10011373 locus=Lus10011373.g ID=Lus10011373.BGIv1.0 annot-version=v1.0
MGDQTTGGSSYSSSSSIFTNYPLIAALVAFAVAQSIKFFTTWYKENRWDLKQFIGSGGMPSSHSSTVCALAMSIGFQEGFGGSLFAAALILSCIVMYDAT
GVRLQAGRQAEVLNQIVYELPAEHPLAESIPLRELLGHTPAQVIAGSLLGVVTAIIGHLITMTTSQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67600 Acid phosphatase/vanadium-depe... Lus10011373 0 1
AT3G57340 Heat shock protein DnaJ, N-ter... Lus10043277 2.0 0.9026
AT5G28040 GeBP DNA-binding storekeeper protei... Lus10000940 4.5 0.8914
AT4G13530 unknown protein Lus10041074 4.5 0.8888
AT5G62440 Protein of unknown function (D... Lus10009570 4.9 0.8665
AT1G11440 unknown protein Lus10007616 5.0 0.8433
AT3G61180 RING/U-box superfamily protein... Lus10029582 5.2 0.8906
AT5G22360 ATVAMP714 vesicle-associated membrane pr... Lus10034189 6.0 0.8878
AT2G35680 Phosphotyrosine protein phosph... Lus10004376 7.5 0.8801
AT3G57340 Heat shock protein DnaJ, N-ter... Lus10019421 7.7 0.8886
AT4G31750 WIN2 HOPW1-1-interacting 2 (.1) Lus10026239 7.9 0.8828

Lus10011373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.