Lus10011378 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26000 75 / 2e-16 Ribonuclease inhibitor (.1)
AT2G01620 51 / 4e-08 MEE11 maternal effect embryo arrest 11, RNI-like superfamily protein (.1)
AT3G27290 49 / 3e-07 RNI-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006438 143 / 7e-41 AT3G26000 240 / 1e-73 Ribonuclease inhibitor (.1)
Lus10037060 100 / 3e-25 AT3G26000 337 / 6e-112 Ribonuclease inhibitor (.1)
Lus10007930 45 / 4e-06 AT2G01620 195 / 9e-61 maternal effect embryo arrest 11, RNI-like superfamily protein (.1)
Lus10013466 39 / 0.0008 AT2G01620 174 / 6e-53 maternal effect embryo arrest 11, RNI-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G054600 92 / 3e-22 AT3G26000 395 / 7e-135 Ribonuclease inhibitor (.1)
Potri.008G179800 87 / 1e-20 AT3G26000 330 / 1e-109 Ribonuclease inhibitor (.1)
Potri.001G337300 78 / 2e-17 AT3G26000 252 / 3e-79 Ribonuclease inhibitor (.1)
Potri.010G108600 60 / 4e-11 AT2G01620 209 / 8e-66 maternal effect embryo arrest 11, RNI-like superfamily protein (.1)
Potri.008G133100 56 / 9e-11 AT2G01620 68 / 2e-14 maternal effect embryo arrest 11, RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10011378 pacid=23159271 polypeptide=Lus10011378 locus=Lus10011378.g ID=Lus10011378.BGIv1.0 annot-version=v1.0
ATGGTTTGTACTTCGCTGCACTCTGCAGTTCGTGACAACCCTTCGTTATGGAGAAGTATTTACATTCATAAACCACTCAATGAGAAGATCACTGATGAAG
TTCTTATCCAACTGACGGATAGGGCTCAAGGTAGTCTAGAGCAGTTGACGATGGTGGAGTGTCAATGGATCACTGATGCTGGACTGAAGCATCTAGCTAG
CTGGTTTATAATCATGCCTTGGACATTGAAACTTGCCCGAAATTCCGCAACCACAAGTTGGTCTATGATTGTCCTGTGGAAAGCTACCAGCAATGGAAGA
AGCATTCTGCTCAGGCTTGTAGAGCTTGCATTCTTTGCATACGGCGGTGTGCTGAGTGCGGTTGCTGTATCAACAACAGTGAATACGTCGAGACTTTTCT
TCTCGAGCATCTGTGTGCATCTTGTGGAAGCGCCAGCTGAAGATGTAAAGATAAAAAACTGGTGA
AA sequence
>Lus10011378 pacid=23159271 polypeptide=Lus10011378 locus=Lus10011378.g ID=Lus10011378.BGIv1.0 annot-version=v1.0
MVCTSLHSAVRDNPSLWRSIYIHKPLNEKITDEVLIQLTDRAQGSLEQLTMVECQWITDAGLKHLASWFIIMPWTLKLARNSATTSWSMIVLWKATSNGR
SILLRLVELAFFAYGGVLSAVAVSTTVNTSRLFFSSICVHLVEAPAEDVKIKNW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26000 Ribonuclease inhibitor (.1) Lus10011378 0 1
AT3G23150 ETR2 ethylene response 2, Signal tr... Lus10021880 6.9 0.7960
Lus10002735 13.5 0.7125
AT2G40940 ERS1 ethylene response sensor 1 (.1... Lus10010310 13.6 0.7761
AT3G09590 CAP (Cysteine-rich secretory p... Lus10009068 16.4 0.7110
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10002986 17.0 0.7467
AT2G40690 SFD1, GLY1 SUPPRESSOR OF FATTY ACID DESAT... Lus10034238 18.7 0.7136
AT3G23150 ETR2 ethylene response 2, Signal tr... Lus10041159 19.6 0.7723
Lus10039878 21.1 0.7532
AT5G60900 RLK1 receptor-like protein kinase 1... Lus10032438 21.1 0.5985
AT2G26690 Major facilitator superfamily ... Lus10018553 24.2 0.7724

Lus10011378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.