Lus10011416 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67856 105 / 4e-30 RING/U-box superfamily protein (.1)
AT1G24580 75 / 2e-18 RING/U-box superfamily protein (.1)
AT2G04240 71 / 3e-16 XERICO RING/U-box superfamily protein (.1.2)
AT1G15100 49 / 6e-08 RHA2A RING-H2 finger A2A (.1)
AT3G61460 48 / 1e-07 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT1G67855 45 / 1e-07 unknown protein
AT3G30460 47 / 2e-07 RING/U-box superfamily protein (.1)
AT2G01150 47 / 2e-07 RHA2B RING-H2 finger protein 2B (.1)
AT3G43430 46 / 6e-07 RING/U-box superfamily protein (.1)
AT1G63840 46 / 1e-06 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034407 50 / 2e-08 AT2G04240 61 / 2e-12 RING/U-box superfamily protein (.1.2)
Lus10019150 50 / 3e-08 AT2G04240 62 / 6e-13 RING/U-box superfamily protein (.1.2)
Lus10036378 50 / 6e-08 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10028773 49 / 1e-07 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Lus10007937 48 / 2e-07 AT1G15100 100 / 2e-27 RING-H2 finger A2A (.1)
Lus10007936 47 / 2e-07 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1)
Lus10013475 47 / 3e-07 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1)
Lus10024657 47 / 4e-07 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10017510 47 / 4e-07 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G047100 133 / 4e-41 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1)
Potri.008G185800 115 / 1e-33 AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1)
Potri.014G170400 81 / 4e-20 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Potri.010G133300 51 / 8e-09 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G133200 51 / 8e-09 AT3G61460 69 / 3e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.007G086300 51 / 1e-08 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.009G170460 50 / 2e-08 AT4G38140 85 / 9e-22 RING/U-box superfamily protein (.1)
Potri.014G087700 49 / 4e-08 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.002G161900 48 / 2e-07 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Potri.010G133700 47 / 2e-07 AT3G61460 66 / 4e-14 brassinosteroid-responsive RING-H2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10011416 pacid=23159205 polypeptide=Lus10011416 locus=Lus10011416.g ID=Lus10011416.BGIv1.0 annot-version=v1.0
ATGGGGCTCTCGAGCTTCCCAACACCTTCAGGAGGAATTCTACCTCTGCTAGTAGTCAACACAGTAATCTCAGTCGCCTTGCTCAAGAACATGCTCAGAT
CTCTGCTTCAGCTTGTTTTCATGGCTTCTTCTCCAATCATCGATCATCATGGTCATCAAGATCGTGACTTGGAACAAAAGAGTAGGAGAATATCGATTAC
CCAGTTCAGATTGCTGAGCTGTGAAGGTTCTTCGAAGGGCGACAATGGCGGAAATGGAACAGAGTGTTGTTGCTGTGTGTGTTTGTGTGGGTTTGAGGAT
GAAGAGGAAGTGAGTGAGTTGTCTTGTAAGCATTTCTTCCACAAAGGTTGTCTTCAGAAGTGGTTCGATAACCGTCACGTTACTTGCCCTCTATGTAGAT
CCATATGA
AA sequence
>Lus10011416 pacid=23159205 polypeptide=Lus10011416 locus=Lus10011416.g ID=Lus10011416.BGIv1.0 annot-version=v1.0
MGLSSFPTPSGGILPLLVVNTVISVALLKNMLRSLLQLVFMASSPIIDHHGHQDRDLEQKSRRISITQFRLLSCEGSSKGDNGGNGTECCCCVCLCGFED
EEEVSELSCKHFFHKGCLQKWFDNRHVTCPLCRSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67856 RING/U-box superfamily protein... Lus10011416 0 1
AT3G11280 MYB Duplicated homeodomain-like su... Lus10040225 2.2 0.8438
AT3G58030 RING/U-box superfamily protein... Lus10004162 2.8 0.8219
AT3G58800 unknown protein Lus10007354 9.3 0.8093
AT3G14460 LRR and NB-ARC domains-contain... Lus10006793 10.2 0.7986
AT5G38250 Protein kinase family protein ... Lus10038814 10.2 0.7850
AT3G06170 Serinc-domain containing serin... Lus10034023 11.2 0.8071
AT3G22560 Acyl-CoA N-acyltransferases (N... Lus10010569 13.9 0.7549
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Lus10040307 17.0 0.8052
AT3G50830 ATCOR413-PM2, C... cold-regulated 413-plasma memb... Lus10023833 17.7 0.7854
AT5G60460 Preprotein translocase Sec, Se... Lus10036119 19.2 0.7517

Lus10011416 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.