Lus10011417 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43870 191 / 1e-58 Pectin lyase-like superfamily protein (.1)
AT3G59850 184 / 7e-56 Pectin lyase-like superfamily protein (.1)
AT1G65570 162 / 2e-47 Pectin lyase-like superfamily protein (.1)
AT2G43860 155 / 8e-45 Pectin lyase-like superfamily protein (.1)
AT2G43890 145 / 5e-41 Pectin lyase-like superfamily protein (.1)
AT2G43880 145 / 5e-41 Pectin lyase-like superfamily protein (.1)
AT1G05660 140 / 4e-39 Pectin lyase-like superfamily protein (.1)
AT1G05650 139 / 2e-38 Pectin lyase-like superfamily protein (.1)
AT1G70500 122 / 8e-32 Pectin lyase-like superfamily protein (.1)
AT3G07850 117 / 5e-30 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002126 330 / 1e-112 AT2G43870 461 / 1e-162 Pectin lyase-like superfamily protein (.1)
Lus10011418 240 / 2e-77 AT2G43870 499 / 2e-177 Pectin lyase-like superfamily protein (.1)
Lus10002124 235 / 9e-76 AT2G43870 505 / 7e-180 Pectin lyase-like superfamily protein (.1)
Lus10022530 214 / 2e-67 AT2G43870 471 / 4e-166 Pectin lyase-like superfamily protein (.1)
Lus10011419 203 / 3e-63 AT2G43870 507 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10002123 200 / 8e-62 AT2G43870 498 / 5e-177 Pectin lyase-like superfamily protein (.1)
Lus10002125 194 / 6e-60 AT3G59850 509 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10008343 141 / 2e-39 AT1G05650 425 / 1e-147 Pectin lyase-like superfamily protein (.1)
Lus10010584 138 / 4e-38 AT1G05660 424 / 2e-147 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G144100 219 / 2e-69 AT2G43870 525 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.017G006200 213 / 2e-66 AT3G59850 503 / 7e-178 Pectin lyase-like superfamily protein (.1)
Potri.010G248200 211 / 2e-66 AT2G43870 534 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.017G005800 209 / 2e-65 AT3G59850 499 / 2e-177 Pectin lyase-like superfamily protein (.1)
Potri.007G144200 207 / 7e-65 AT3G59850 482 / 1e-170 Pectin lyase-like superfamily protein (.1)
Potri.007G144400 206 / 1e-64 AT3G59850 476 / 2e-168 Pectin lyase-like superfamily protein (.1)
Potri.017G005300 205 / 4e-64 AT3G59850 504 / 3e-179 Pectin lyase-like superfamily protein (.1)
Potri.017G003500 205 / 5e-64 AT3G59850 498 / 4e-177 Pectin lyase-like superfamily protein (.1)
Potri.017G005600 205 / 5e-64 AT3G59850 496 / 5e-176 Pectin lyase-like superfamily protein (.1)
Potri.017G004500 204 / 1e-63 AT3G59850 520 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10011417 pacid=23182579 polypeptide=Lus10011417 locus=Lus10011417.g ID=Lus10011417.BGIv1.0 annot-version=v1.0
ATGGGCACTGGCCTGCGGTTACACGTGCCAAAAGGAAGGTTCCTTATTGAGAGGAGCATGGAGTTGAAGGGACCATGTAGCAATAACGCCATATTCGTTC
GCATTGACGGCACCCTCGTCGCCGCCTCTGACATCTGGGCTATTAACAACGACCCTAACTGGATTGGCTTCAGCAAGGTTGACGGCGTCACAATCTCCGG
AGGCTTCCTTGACGGCAAGGGCGCCCCTTTGTGGTCCTGCAAGATGAACGACACTCAGAATTGTCCGACCGGCGCTACGAACTCGAAGAATGTGATAGTG
AGTCGGGTGACATCAGTCAACACACATATGTTCCACCTAGTCATAAATCACTGCGAAAATGTGAGGGTGCAAGGTGTAACGCTCATAGCTCTTGGAAACT
CTCTCAACACCGATGGAATCCATGTCCAGTTATCCACCGGAGTCACCATCGTCAACTCCAAAATCTCAACCGGCGACGATTGCATCTCCATTGGTGCAGG
CGCCGCCAACTTGTGGATCGAGAATGTAGCATCGGGCGTCCAAGTCAACGACGTGACCTACGAGGACATACAAGGAACATCGGCTACGGAAGTTGCGGTG
AAGTTTGACTGCAGCAGCGAGAAACCTTGCAGAGGGATCAGATTGGAGAATGTTAAGCTTACTTACGACAAAGAACCAGCTGCTGTTGCGTTGTCGTATT
GCGCACACGCGCTTGGAACCGCGATTGGCATTGTCCAACCAACCAGCTGCTTGATATTTGCAAGCACCCCCTCAAAGGGAAATTTATATTGA
AA sequence
>Lus10011417 pacid=23182579 polypeptide=Lus10011417 locus=Lus10011417.g ID=Lus10011417.BGIv1.0 annot-version=v1.0
MGTGLRLHVPKGRFLIERSMELKGPCSNNAIFVRIDGTLVAASDIWAINNDPNWIGFSKVDGVTISGGFLDGKGAPLWSCKMNDTQNCPTGATNSKNVIV
SRVTSVNTHMFHLVINHCENVRVQGVTLIALGNSLNTDGIHVQLSTGVTIVNSKISTGDDCISIGAGAANLWIENVASGVQVNDVTYEDIQGTSATEVAV
KFDCSSEKPCRGIRLENVKLTYDKEPAAVALSYCAHALGTAIGIVQPTSCLIFASTPSKGNLY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G43870 Pectin lyase-like superfamily ... Lus10011417 0 1
AT1G02335 GL22 germin-like protein subfamily ... Lus10004856 1.0 1.0000
Lus10002332 2.0 1.0000
AT3G05950 RmlC-like cupins superfamily p... Lus10023351 3.0 1.0000
AT3G53710 AGD6 ARF-GAP domain 6 (.1.2) Lus10012991 3.5 1.0000
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10014056 3.9 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10031075 4.2 1.0000
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10033189 4.6 1.0000
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Lus10033628 4.9 1.0000
Lus10030331 4.9 0.9864
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10010873 5.1 0.9701

Lus10011417 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.