Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14860 286 / 1e-97 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G33905 281 / 2e-95 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT5G43140 223 / 1e-72 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT5G19750 99 / 4e-24 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G03410 80 / 4e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT3G24570 78 / 6e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT1G52870 80 / 7e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT2G42770 64 / 8e-12 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G04470 61 / 4e-11 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G14305 57 / 1e-09 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002118 [exp] 460 / 1e-165 AT2G14860 292 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10018700 [exp] 223 / 3e-71 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10007761 [exp] 192 / 2e-58 AT5G43140 223 / 1e-70 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10039003 [exp] 92 / 7e-22 AT5G19750 241 / 1e-79 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10012098 [exp] 89 / 1e-20 AT5G19750 259 / 4e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10034922 [exp] 88 / 1e-20 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10023648 [exp] 88 / 2e-20 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10010446 [exp] 86 / 2e-19 AT5G19750 258 / 2e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10038626 [exp] 82 / 2e-18 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G296400 [exp] 307 / 2e-105 AT2G14860 300 / 6e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.009G090600 [exp] 298 / 4e-102 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.014G017800 [exp] 155 / 3e-47 AT5G43140 183 / 2e-58 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.006G032500 [exp] 103 / 1e-25 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.016G029700 [exp] 98 / 7e-24 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.018G037100 [exp] 82 / 2e-18 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.018G081600 [exp] 77 / 7e-17 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.001G404600 [exp] 78 / 2e-16 AT1G52870 438 / 6e-154 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.011G123700 [exp] 77 / 6e-16 AT1G52870 472 / 1e-167 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.019G103200 [exp] 72 / 4e-14 AT4G03410 413 / 2e-145 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04117 [flax] [poplar] Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence Show only first row Show all	>Lus10011424 pacid=23182645 polypeptide=Lus10011424 locus=Lus10011424.g ID=Lus10011424.BGIv1.0 annot-version=v1.0 ATGAGCGGCGCATTCATGTCGAAATCCTCCGTCCTCCGTGTCTTACGCGCCCGCATCGCCGACCCAGCGATATCGACGACGTCGACCGTTAACGGCCTTC TGAGGAACCAAACGACATCGTCGCCGCCGTCGAGAGCTCAATACTATCTGCGGTTGCCTTCTCATCGTTTCAGGAAATCCAGCAATGACTTCTCCCCTTC AGCAACCTTCTCTTCTGCTTTCTCTTCTTCGGCTTCTACTTCTACGGGGTCGTCGGCTACAAGGATTCCTTTCGTCTCGTGGTACCTGGATATGGTGAAA GCTCGTCCTATATTGACCAAGAGCCTCACCGCCTCGTTTATTTACACTGCAGCTGACCTTTCTTCTCAGACAATTTCAAAGGCCAGTTCAGTGCCATATG ACTACGACTTGATGAGGACATCCCGGATGGCTGGATACGGGCTGCTAATTCTAGGGCCATCGCTGCATTATTGGTTCAACTTCGTCTCAAAGCTCTTCCC GAATCGAGATTTCGTTGCCACTTTGAAGAAAATGGCCATGGGACAGGCCATCTACGGACCTATTATGACTGTCGTGTTCTTCTCCACGATCGCTAGATTA CAGGGTGAGAATGGTGCTGAGATTATGGCGCGGTTAAAAAGAGATCTACTTCCAACGATGCTCAATGGCGTTATGTACTGGCCGCTCTGTGATTTCATAA CTTTCAGATTCATCCCTGTCCATCTGCAGCCGTTGGTGAGCAATTCCTTCTCCTACTTGTGGACTGTCTACATGACATACATGGCTAGTAAAGACAAAGT TGCAGCAGCAGCAGCCACCTAG
AA sequence Show only first row Show all	>Lus10011424 pacid=23182645 polypeptide=Lus10011424 locus=Lus10011424.g ID=Lus10011424.BGIv1.0 annot-version=v1.0 MSGAFMSKSSVLRVLRARIADPAISTTSTVNGLLRNQTTSSPPSRAQYYLRLPSHRFRKSSNDFSPSATFSSAFSSSASTSTGSSATRIPFVSWYLDMVK ARPILTKSLTASFIYTAADLSSQTISKASSVPYDYDLMRTSRMAGYGLLILGPSLHYWFNFVSKLFPNRDFVATLKKMAMGQAIYGPIMTVVFFSTIARL QGENGAEIMARLKRDLLPTMLNGVMYWPLCDFITFRFIPVHLQPLVSNSFSYLWTVYMTYMASKDKVAAAAAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14860			Peroxisomal membrane 22 kDa (M...		Lus10011424 [exp]	0	1
AT5G64170			dentin sialophosphoprotein-rel...		Lus10015846 [exp]	4.2	0.7751
AT3G55580			Regulator of chromosome conden...		Lus10040266 [exp]	6.5	0.7104
AT1G68720		ATTADA, TADA	ARABIDOPSIS THALIANA TRNA ADEN...		Lus10034402 [exp]	8.5	0.6997
AT3G55580			Regulator of chromosome conden...		Lus10004700 [exp]	12.5	0.6952
AT5G53280		PDV1	plastid division1 (.1)		Lus10027574 [exp]	13.4	0.6562
AT1G18330	MYB	RVE7, EPR1	REVEILLE 7, EARLY-PHYTOCHROME-...		Lus10042292 [exp]	13.6	0.6980
AT5G59480			Haloacid dehalogenase-like hyd...		Lus10040786 [exp]	15.2	0.6829
AT4G38960	CO		B-box type zinc finger family ...		Lus10031087 [exp]	16.1	0.6841
AT1G01860		PFC1	PALEFACE 1, Ribosomal RNA aden...		Lus10009319 [exp]	19.1	0.6580
AT3G47500	DOF	CDF3, AtDof3,3	cycling DOF factor 3 (.1)		Lus10034461 [exp]	23.5	0.6901

Compare expression of checked genes

Lus10011424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.