Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60540 79 / 3e-21 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) AT2G45070 79 / 4e-21 SEC61 BETA, SEC61BETA SUPPRESSORS OF SECRETION-DEFECTIVE 61 BETA, Preprotein translocase Sec, Sec61-beta subunit protein (.1.2.3.4) AT5G60460 65 / 2e-15 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037570 [exp] 93 / 2e-26 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10025029 [exp] 90 / 4e-25 AT3G60540 107 / 2e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10010009 [exp] 89 / 4e-25 AT3G60540 109 / 3e-33 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10036119 [exp] 61 / 2e-13 AT5G60460 108 / 6e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G143100 [exp] 90 / 2e-25 AT3G60540 86 / 1e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Potri.014G059000 [exp] 88 / 1e-24 AT3G60540 81 / 7e-22 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Potri.009G012000 [exp] 60 / 2e-13 AT5G60460 86 / 6e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03911 [flax] [poplar] Sec61_beta Sec61beta family
Representative CDS sequence Show only first row Show all	>Lus10011428 pacid=23182615 polypeptide=Lus10011428 locus=Lus10011428.g ID=Lus10011428.BGIv1.0 annot-version=v1.0 ATGGCTCTAGGTGGAACAGCTCCCCCAAGAGGAAGCGCAGCTGCTGCTGCAAGCATGCGCAGGAGGAGGACCACTAGCGGCGCTGCTTCAGGAGGAGCCG CCGGAACAATGCTCCAGTTCTACACCGATGATGCTCCGGGGCTGAAGATATCTCCTAACGTAGTCCTGTTTATGAGCATCGGTTTCATCGCTTTCGTTGC CATTCTCCATGTGGTTGGTAAGATATACCTTGTTCGGAGGGAGGCTTAA
AA sequence Show only first row Show all	>Lus10011428 pacid=23182615 polypeptide=Lus10011428 locus=Lus10011428.g ID=Lus10011428.BGIv1.0 annot-version=v1.0 MALGGTAPPRGSAAAAASMRRRRTTSGAASGGAAGTMLQFYTDDAPGLKISPNVVLFMSIGFIAFVAILHVVGKIYLVRREA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60540			Preprotein translocase Sec, Se...		Lus10011428 [exp]	0	1
AT3G60540			Preprotein translocase Sec, Se...		Lus10037570 [exp]	3.0	0.9220
AT5G08335		ATICMTB, ATSTE1...	ARABIDOPSIS THALIANA ISOPRENYL...		Lus10037842 [exp]	3.9	0.8989
AT2G33040		ATP3	gamma subunit of Mt ATP syntha...		Lus10042366 [exp]	4.2	0.9222
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10031085 [exp]	4.9	0.9116
AT4G11260		RPR1, ETA3, EDM...	ENHANCER OF TIR1-1 AUXIN RESIS...		Lus10027540 [exp]	5.5	0.9187
AT5G67590		FRO1	FROSTBITE1, NADH-ubiquinone ox...		Lus10019261 [exp]	6.3	0.9213
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10015106 [exp]	6.6	0.9257
AT3G25220		FKBP15-1	FK506-binding protein 15 kD-1 ...		Lus10003170 [exp]	6.6	0.9073
AT5G47570			unknown protein		Lus10000735 [exp]	8.3	0.8940
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10022019 [exp]	11.2	0.9200

Compare expression of checked genes

Lus10011428 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.