Lus10011435 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02340 130 / 1e-37 alpha/beta-Hydrolases superfamily protein (.1)
AT3G05600 116 / 3e-32 alpha/beta-Hydrolases superfamily protein (.1)
AT4G15955 105 / 1e-28 alpha/beta-Hydrolases superfamily protein (.1.2.3)
AT4G15960 104 / 2e-27 alpha/beta-Hydrolases superfamily protein (.1)
AT2G26740 102 / 4e-27 ATSEH soluble epoxide hydrolase (.1)
AT2G26750 100 / 2e-26 alpha/beta-Hydrolases superfamily protein (.1)
AT3G51000 83 / 7e-20 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037559 219 / 2e-72 AT4G02340 367 / 2e-127 alpha/beta-Hydrolases superfamily protein (.1)
Lus10006827 217 / 2e-71 AT4G02340 380 / 8e-133 alpha/beta-Hydrolases superfamily protein (.1)
Lus10037577 214 / 3e-70 AT4G02340 384 / 6e-134 alpha/beta-Hydrolases superfamily protein (.1)
Lus10008683 124 / 2e-35 AT4G02340 428 / 1e-151 alpha/beta-Hydrolases superfamily protein (.1)
Lus10008684 122 / 6e-35 AT4G02340 369 / 1e-128 alpha/beta-Hydrolases superfamily protein (.1)
Lus10026141 122 / 2e-34 AT4G02340 446 / 6e-159 alpha/beta-Hydrolases superfamily protein (.1)
Lus10004439 120 / 4e-34 AT4G02340 384 / 3e-134 alpha/beta-Hydrolases superfamily protein (.1)
Lus10009859 118 / 9e-34 AT4G02340 349 / 6e-122 alpha/beta-Hydrolases superfamily protein (.1)
Lus10010293 115 / 4e-32 AT4G02340 476 / 1e-170 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G127200 136 / 3e-40 AT4G02340 519 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G081000 136 / 8e-40 AT4G02340 455 / 1e-161 alpha/beta-Hydrolases superfamily protein (.1)
Potri.002G202700 132 / 9e-39 AT4G02340 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010800 119 / 2e-33 AT4G15960 413 / 1e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010900 116 / 2e-32 AT4G15960 412 / 3e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010700 113 / 3e-31 AT4G15960 404 / 2e-141 alpha/beta-Hydrolases superfamily protein (.1)
Potri.013G013500 110 / 3e-30 AT3G05600 425 / 2e-150 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G023400 92 / 4e-24 AT3G05600 238 / 8e-79 alpha/beta-Hydrolases superfamily protein (.1)
Potri.007G018900 84 / 5e-20 AT3G51000 454 / 9e-162 alpha/beta-Hydrolases superfamily protein (.1)
Potri.004G039700 54 / 2e-09 AT3G51000 203 / 2e-63 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10011435 pacid=23182649 polypeptide=Lus10011435 locus=Lus10011435.g ID=Lus10011435.BGIv1.0 annot-version=v1.0
ATGGTGCCCAAAGAAACAGGACTCAAAGGGTTACCAGATCCACCAACCTCATTCCTCCCATGGCTGCCGGAAGAAGACGTGGATTACTACGCGTCCCAGT
TCAGCAAGACCGGGTTCACCGGAGGACTCAACTACTACCGAGCCTTCTCCCTCACCAGGGAACTGATGGGGCCATGGTCAGGAGGAGATTGCAAGTATCA
AGTCCCGGCTAAGTTCATCATTGGGGATCAAGACGTTTGCTACCACATGCCTGGGATGAAGGACTACATACATGGTGGAGAGTTTAAGAAGGAAGTTCCG
ATGCTCGAAGAAGTCGTGGTCATGGAAGGGGTGCCGCATTTCGCGAACCTGGTCAAGCCGGAGGAGGTCACTCGGCACATCGTCGACTTCATCAAACGTT
TCTGA
AA sequence
>Lus10011435 pacid=23182649 polypeptide=Lus10011435 locus=Lus10011435.g ID=Lus10011435.BGIv1.0 annot-version=v1.0
MVPKETGLKGLPDPPTSFLPWLPEEDVDYYASQFSKTGFTGGLNYYRAFSLTRELMGPWSGGDCKYQVPAKFIIGDQDVCYHMPGMKDYIHGGEFKKEVP
MLEEVVVMEGVPHFANLVKPEEVTRHIVDFIKRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02340 alpha/beta-Hydrolases superfam... Lus10011435 0 1
AT2G22590 UDP-Glycosyltransferase superf... Lus10043446 5.6 0.7803
AT1G60030 ATNAT7 ARABIDOPSIS NUCLEOBASE-ASCORBA... Lus10005717 9.4 0.7719
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10020736 18.2 0.7717
AT1G61100 disease resistance protein (TI... Lus10025112 19.7 0.7614
AT1G48320 Thioesterase superfamily prote... Lus10036869 20.5 0.7637
AT5G39960 GTP binding;GTP binding (.1) Lus10033794 22.6 0.7447
AT2G39260 binding;RNA binding (.1) Lus10030801 23.7 0.7551
AT4G21440 MYB ATMYB102, ATM4 A. THALIANA MYB 4, MYB-like 10... Lus10018547 26.5 0.7432
AT5G65550 UDP-Glycosyltransferase superf... Lus10028864 32.9 0.7476
AT1G74400 Tetratricopeptide repeat (TPR)... Lus10002903 33.2 0.6848

Lus10011435 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.