Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007504 [exp] 53 / 1e-09 AT3G22040 42 / 3e-05 Domain of unknown function (DUF26) (.1) Lus10028980 [exp] 52 / 4e-09 AT3G21945 39 / 9e-04 Receptor-like protein kinase-related family protein (.1) Lus10013255 [exp] 50 / 5e-09 ND / Lus10012853 [exp] 48 / 5e-08 AT3G22060 44 / 6e-06 Receptor-like protein kinase-related family protein (.1) Lus10030777 [exp] 47 / 9e-08 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1) Lus10030780 [exp] 46 / 3e-07 ND 36 / 0.004 Lus10013260 [exp] 46 / 3e-07 ND 37 / 0.003 Lus10030782 [exp] 44 / 9e-07 ND 39 / 4e-04 Lus10030779 [exp] 44 / 2e-06 AT1G70690 36 / 0.005 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G023876 [exp] 42 / 2e-05 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024140 [exp] 39 / 0.0001 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10011438 pacid=23182582 polypeptide=Lus10011438 locus=Lus10011438.g ID=Lus10011438.BGIv1.0 annot-version=v1.0 ATGCACCGCCCGATCACAACGGCAGACTACGCGTCGTACGTGCAGCACGTGCTGGCCGTGCTGGCCACGGTCACGCCCAACACACTAGGCAAGGCGTACG GCACGACGTTCCCGTCCGATTCCCCTGGCTATGTCCAAGGCGTTGCCATGTGTACCCACACGTCGGACGCCAGCGGCTGCGGTGGCTGCCTCGAGGGTCT CAGAAAACAGTTGATCGAAGACTGCGGTCAAAAAGAAGGCGGCAAGTATCAGAGAGTCGGCGTTTGCCAGATGCTTTTTGATGTCATTGGTTAA
AA sequence Show only first row Show all	>Lus10011438 pacid=23182582 polypeptide=Lus10011438 locus=Lus10011438.g ID=Lus10011438.BGIv1.0 annot-version=v1.0 MHRPITTADYASYVQHVLAVLATVTPNTLGKAYGTTFPSDSPGYVQGVAMCTHTSDASGCGGCLEGLRKQLIEDCGQKEGGKYQRVGVCQMLFDVIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011438 [exp]	0	1
AT5G08370		ATAGAL2	alpha-galactosidase 2 (.1.2)		Lus10018258 [exp]	1.0	0.8698
AT4G25190		QWRF7	QWRF domain containing 7, Fami...		Lus10009604 [exp]	2.6	0.8084
AT2G15220			Plant basic secretory protein ...		Lus10026585 [exp]	2.8	0.7979
AT2G32645			Domain of unknown function (DU...		Lus10020591 [exp]	3.2	0.7683
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10018718 [exp]	4.5	0.8093
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023036 [exp]	5.5	0.8093
AT1G06340			Plant Tudor-like protein (.1)		Lus10039027 [exp]	6.3	0.8093
AT3G07820			Pectin lyase-like superfamily ...		Lus10002931 [exp]	6.7	0.6683
AT5G07050			nodulin MtN21 /EamA-like trans...		Lus10026113 [exp]	6.7	0.7870
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10026169 [exp]	7.1	0.8093

Compare expression of checked genes

Lus10011438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.