Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52240 164 / 1e-54 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 144 / 1e-46 Dynein light chain type 1 family protein (.1) AT4G27360 102 / 6e-30 Dynein light chain type 1 family protein (.1) AT4G15930 79 / 2e-20 Dynein light chain type 1 family protein (.1) AT5G20110 79 / 2e-19 Dynein light chain type 1 family protein (.1) AT1G23220 69 / 3e-16 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037551 [exp] 180 / 1e-60 AT1G52240 157 / 2e-51 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 170 / 1e-56 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10025794 [exp] 169 / 2e-56 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 116 / 2e-35 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 115 / 4e-35 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 99 / 2e-28 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 72 / 3e-17 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 69 / 1e-15 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 69 / 2e-15 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G052800 [exp] 170 / 5e-57 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.006G091800 [exp] 117 / 8e-36 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G407900 [exp] 102 / 1e-29 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 99 / 3e-28 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 97 / 1e-27 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 77 / 1e-19 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 72 / 1e-17 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 72 / 1e-17 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 73 / 2e-17 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 72 / 3e-17 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10011443 pacid=23182617 polypeptide=Lus10011443 locus=Lus10011443.g ID=Lus10011443.BGIv1.0 annot-version=v1.0 ATGTTGGAAGGGAAAGCAGTAGTTGATGATGCAGACATGCCAGAGAAAATGCAGGCACAAGCCATGGCTTCTGCATATGAAGCTCTGGATCTCTATGATG TCAGTGACTGCCTATCCATCGCTGGCCACATCAAGAAGGAGTTTGATGTGAGATATGGAGGTGGATGGCAATGTGTAGTGGGCTCAAACTTTGGATGCTT CTTCACACACTCAAAAGGCACTTTCGTCTACTTCACATTGGAGACTCTCAAGTTCCTCATCTTCAAAGGGGTTTCTTCTCCCTGA
AA sequence Show only first row Show all	>Lus10011443 pacid=23182617 polypeptide=Lus10011443 locus=Lus10011443.g ID=Lus10011443.BGIv1.0 annot-version=v1.0 MLEGKAVVDDADMPEKMQAQAMASAYEALDLYDVSDCLSIAGHIKKEFDVRYGGGWQCVVGSNFGCFFTHSKGTFVYFTLETLKFLIFKGVSSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10011443 [exp]	0	1
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10015318 [exp]	1.4	0.8732
AT4G03140			NAD(P)-binding Rossmann-fold s...		Lus10040909 [exp]	2.4	0.8665
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10036746 [exp]	2.8	0.8678
AT5G42250			Zinc-binding alcohol dehydroge...		Lus10040457 [exp]	3.9	0.8602
AT4G30360		ATCNGC17	cyclic nucleotide-gated channe...		Lus10008900 [exp]	5.1	0.8178
AT1G25440	CO	COL16	B-box type zinc finger protein...		Lus10034322 [exp]	5.7	0.8612
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Lus10019831 [exp]	7.9	0.7777
AT3G57910			D111/G-patch domain-containing...		Lus10021033 [exp]	10.2	0.8334
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10012570 [exp]	10.5	0.8247
AT1G25440	CO	COL16	B-box type zinc finger protein...		Lus10041449 [exp]	11.5	0.8532

Compare expression of checked genes

Lus10011443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.