Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52300 160 / 4e-53 Zinc-binding ribosomal protein family protein (.1) AT1G15250 160 / 5e-53 Zinc-binding ribosomal protein family protein (.1) AT3G16080 158 / 3e-52 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037549 [exp] 190 / 1e-64 AT3G16080 160 / 8e-53 Zinc-binding ribosomal protein family protein (.1) Lus10035878 [exp] 190 / 2e-63 AT3G16080 166 / 1e-53 Zinc-binding ribosomal protein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G036900 [exp] 179 / 1e-60 AT1G15250 167 / 1e-55 Zinc-binding ribosomal protein family protein (.1) Potri.003G053100 [exp] 173 / 3e-58 AT3G16080 172 / 8e-58 Zinc-binding ribosomal protein family protein (.1) Potri.006G243300 [exp] 172 / 1e-57 AT1G15250 170 / 1e-56 Zinc-binding ribosomal protein family protein (.1) Potri.001G183200 [exp] 172 / 2e-57 AT3G16080 172 / 8e-58 Zinc-binding ribosomal protein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01907 [flax] [poplar] Ribosomal_L37e Ribosomal protein L37e
Representative CDS sequence Show only first row Show all	>Lus10011446 pacid=23182605 polypeptide=Lus10011446 locus=Lus10011446.g ID=Lus10011446.BGIv1.0 annot-version=v1.0 ATGGGTAAGGGTACAGGGAGTTTCGGTAAGAGGAGGAACAAGACCCACACCCTCTGTGTGAGGTGCGGCCGCCGCAGTTTTCATCTCCAGAAGAGTCGCT GCTCCGCTTGTGCTTACCCTGCCGCCCGCGTCAGGAAATACAACTGGAGTGAGAAGGCTATCCGCCGAAAGACAACCGGAACTGGAAGGATGAGGTACAT GCGCCATATGGCTCGCAGGTTCAAGAGTGGATTCAGAGAGGGCACTCAAGCTGCGCCAAGGACCAAGGGAACTGCTGCAGCATCATCTTAA
AA sequence Show only first row Show all	>Lus10011446 pacid=23182605 polypeptide=Lus10011446 locus=Lus10011446.g ID=Lus10011446.BGIv1.0 annot-version=v1.0 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSEKAIRRKTTGTGRMRYMRHMARRFKSGFREGTQAAPRTKGTAAASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G16080			Zinc-binding ribosomal protein...		Lus10011446 [exp]	0	1
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10036911 [exp]	1.4	0.9371
AT4G15000			Ribosomal L27e protein family ...		Lus10039017 [exp]	2.0	0.9257
AT5G57120			unknown protein		Lus10001627 [exp]	2.8	0.9001
AT1G26740			Ribosomal L32p protein family ...		Lus10008442 [exp]	4.2	0.9055
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Lus10009963 [exp]	4.9	0.8890
AT4G21110			G10 family protein (.1)		Lus10014385 [exp]	5.5	0.8808
AT3G12530		PSF2	PSF2 (.1.2)		Lus10002696 [exp]	7.1	0.9056
AT3G07590			Small nuclear ribonucleoprotei...		Lus10016068 [exp]	7.2	0.8709
AT4G40030			Histone superfamily protein (....		Lus10013946 [exp]	7.9	0.9161
AT1G05205			unknown protein		Lus10027173 [exp]	9.2	0.8811

Compare expression of checked genes

Lus10011446 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.