Lus10011455 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79910 217 / 1e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 154 / 9e-44 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G32350 160 / 1e-43 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G35730 120 / 2e-30 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 109 / 3e-26 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G25420 101 / 3e-24 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT2G14830 97 / 4e-22 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G19710 91 / 9e-20 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 88 / 1e-18 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G13340 78 / 8e-16 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037536 476 / 3e-169 AT1G79910 191 / 2e-57 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10025932 308 / 6e-98 AT5G48840 440 / 2e-149 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10035885 290 / 2e-94 AT1G79910 235 / 1e-72 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10025779 245 / 1e-76 AT1G79910 199 / 8e-59 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10034905 199 / 3e-58 AT4G32350 256 / 3e-75 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10023635 196 / 5e-57 AT4G32350 252 / 9e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10038167 148 / 8e-40 AT5G48840 447 / 7e-155 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10006061 124 / 2e-31 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10028724 122 / 6e-31 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G181300 246 / 9e-77 AT1G79910 244 / 1e-75 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054500 224 / 2e-68 AT1G79910 216 / 4e-65 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.018G079500 180 / 3e-51 AT4G32350 240 / 1e-69 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.003G054700 166 / 5e-47 AT1G79910 141 / 1e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054601 161 / 3e-45 AT1G79910 140 / 3e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.013G117100 121 / 3e-30 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.007G059800 115 / 1e-28 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.008G121300 112 / 3e-28 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.019G087400 114 / 7e-28 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.013G135700 100 / 3e-23 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10011455 pacid=23182590 polypeptide=Lus10011455 locus=Lus10011455.g ID=Lus10011455.BGIv1.0 annot-version=v1.0
ATGTTTGATAGCTTGACCAAGTCCAAATTCTACACGAAATGCAAGTCGTTGACGAAGATGACGAAGGTGAGGCTGGATTCGTCGGCGAAGAAGAAGAAAG
CTGTGGCTAAGTATCTGAGACGCGACATCGCTGAGCTTCTGAGGAATGGCCTCAATTCCAATGCTTACGGCAGGGCTGAAGGGCTTATAGTGGAGCAGAA
CATGGTAGCTGCTTACAAGTTCATGGACGAATTCTGCGACTGCATTTCCACCAATCTTGCTACCTTAGACAAACAGATGGAATGCCCAAAGGAATGCAGA
GAAGCCATACAGAGTTTGATGTATGCAGCAGCGAGGTTTGCGGAGTTCCCAGAACTCCGCGACCTTCGATCTGTGTTTGCACAGAGATACGGAGATTGTC
TCGAATTGTTTCTTAACAAAGAGTTTGGTGAGCTACTGAATCCAAGGCCTGCTACAAAGGAGATGAAGCTTCAGCTACTTGTTGATGTTGCGCAAGAATT
CTCCATCGAATGGGATCCGAAACTTTTCGATCAGAAGCTCTCGAAACCTGACAATAATCCTCATGGTGTAGCGAACTTGTCGAGAAGACGGAGCGAAGCA
GGAGCAGAACCAGCTGCTCCGGTTTACGTCAGAGCCAGGAGTGACTCCACAGCAACAAGGAGAGCCTCCATTAGTACTGCTTCTCCCGTTGCTTCAGATG
ATAATAATCCTTCCAAGTTCATGCCTCCGCCACCGTATGTCCGGGCCAATCCTGAAGCCTTACAACAGAAGCCTCGATCCGTTCGACAAAGGCAACAGGC
AACAAAACTGGATGAGGAGGAAAGGAAGCTCAACGAGCTATTGATACAGCAGAGCGGAAAGAGAACGACGGCTTACGAGAGGAGCGTTACTCATACAACC
GGTACGAAGCCTCTTTCTTGGCGGTCAAGGGACGGTGATCAGAGGCATGCTCGATCTCTATCAGAAGTGCCTTCAGGACATGTGCATCCGAACCTACCTG
ATTACGATTCGTTGGCGGATCGGATCGCTTCGATCAAGGGGGAAAATTGGTGA
AA sequence
>Lus10011455 pacid=23182590 polypeptide=Lus10011455 locus=Lus10011455.g ID=Lus10011455.BGIv1.0 annot-version=v1.0
MFDSLTKSKFYTKCKSLTKMTKVRLDSSAKKKKAVAKYLRRDIAELLRNGLNSNAYGRAEGLIVEQNMVAAYKFMDEFCDCISTNLATLDKQMECPKECR
EAIQSLMYAAARFAEFPELRDLRSVFAQRYGDCLELFLNKEFGELLNPRPATKEMKLQLLVDVAQEFSIEWDPKLFDQKLSKPDNNPHGVANLSRRRSEA
GAEPAAPVYVRARSDSTATRRASISTASPVASDDNNPSKFMPPPPYVRANPEALQQKPRSVRQRQQATKLDEEERKLNELLIQQSGKRTTAYERSVTHTT
GTKPLSWRSRDGDQRHARSLSEVPSGHVHPNLPDYDSLADRIASIKGENW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G79910 Regulator of Vps4 activity in ... Lus10011455 0 1
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Lus10034045 1.0 0.9375
AT1G03220 Eukaryotic aspartyl protease f... Lus10021938 4.0 0.9036
AT2G37050 Leucine-rich repeat protein ki... Lus10023166 5.2 0.8687
AT5G15290 CASP5 Casparian strip membrane domai... Lus10015375 5.7 0.8962
AT1G68370 ARG1 ALTERED RESPONSE TO GRAVITY 1,... Lus10005113 7.3 0.8473
AT5G02100 UNE18, ORP3A UNFERTILIZED EMBRYO SAC 18, OS... Lus10010843 8.1 0.8804
AT5G67360 ARA12 Subtilase family protein (.1) Lus10018721 9.0 0.8320
AT5G35370 S-locus lectin protein kinase ... Lus10028067 9.3 0.8120
AT3G11550 CASP2 Casparian strip membrane domai... Lus10004205 11.0 0.8809
AT1G11940 Core-2/I-branching beta-1,6-N-... Lus10020037 11.0 0.8472

Lus10011455 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.