Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16000 105 / 3e-31 unknown protein AT1G80890 76 / 9e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023116 [exp] 129 / 7e-41 AT1G16000 120 / 2e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G043300 [exp] 95 / 2e-27 AT1G16000 106 / 5e-32 unknown protein Potri.003G183501 [exp] 61 / 7e-14 AT1G16000 68 / 1e-16 unknown protein Potri.004G051201 [exp] 47 / 1e-08 AT1G16000 52 / 4e-10 unknown protein Potri.008G111650 [exp] 37 / 0.0001 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011478 pacid=23182588 polypeptide=Lus10011478 locus=Lus10011478.g ID=Lus10011478.BGIv1.0 annot-version=v1.0 ATGGGAAGTGAGTCGAAAACCGGCGGCGCCACCAATGGAGGAGGAGGAGCGGGAGGGTTCAAGTCGAAGGTAGAGCATGCCTTGTACAGCGGAGAAAAGA AGTATGTCATCGGCGGAATAGCTGTCATATCTGTAATCTTCGGCATCCCTTGGTACCTCATGAACAGAGGATCAAAGCATCAGTCACATCAAGATTACAT GGACAAGGCCGATAATGCCAGGAAGGCAAGGCTTTCGTCTAGCTCTTCTGCTACCTGA
AA sequence Show only first row Show all	>Lus10011478 pacid=23182588 polypeptide=Lus10011478 locus=Lus10011478.g ID=Lus10011478.BGIv1.0 annot-version=v1.0 MGSESKTGGATNGGGGAGGFKSKVEHALYSGEKKYVIGGIAVISVIFGIPWYLMNRGSKHQSHQDYMDKADNARKARLSSSSSAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G16000			unknown protein		Lus10011478 [exp]	0	1
AT5G18800			Cox19-like CHCH family protein...		Lus10012784 [exp]	2.2	0.7979
AT2G27020		PAG1	20S proteasome alpha subunit G...		Lus10041296 [exp]	2.4	0.8095
AT2G18400			ribosomal protein L6 family pr...		Lus10014306 [exp]	4.6	0.8071
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10040717 [exp]	4.8	0.8257
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10023702 [exp]	6.9	0.7924
					Lus10003566 [exp]	9.9	0.7852
AT2G18196			Heavy metal transport/detoxifi...		Lus10010147 [exp]	12.0	0.8034
AT2G31490			unknown protein		Lus10027603 [exp]	12.0	0.7766
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10022716 [exp]	15.9	0.7508
AT4G18905			Transducin/WD40 repeat-like su...		Lus10015348 [exp]	16.3	0.7680

Compare expression of checked genes

Lus10011478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.