Lus10011495 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G34370 96 / 8e-25 C2H2ZnF STOP1 sensitive to proton rhizotoxicity 1, C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
AT5G22890 88 / 1e-21 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
AT5G03150 54 / 1e-09 C2H2ZnF JKD JACKDAW, C2H2-like zinc finger protein (.1)
AT5G66730 54 / 1e-09 C2H2ZnF IDD1, ENY INDETERMINATE DOMAIN 1, ENHYDROUS, C2H2-like zinc finger protein (.1)
AT3G13810 54 / 2e-09 C2H2ZnF ATIDD11 indeterminate(ID)-domain 11 (.1), indeterminate(ID)-domain 11 (.2), indeterminate(ID)-domain 11 (.3)
AT3G50700 54 / 3e-09 C2H2ZnF ATIDD2 indeterminate(ID)-domain 2 (.1)
AT5G44160 53 / 3e-09 C2H2ZnF AtIDD8, NUC nutcracker, INDETERMINATE DOMAIN 8, C2H2-like zinc finger protein (.1)
AT1G55110 52 / 1e-08 C2H2ZnF ARABIDOPSISTHALIANAINDETERMINATE(ID)-DOMAIN7, ATIDD7, ARABIDOPSISTHALIANAINDETERMINATE(ID)-DOMAIN7 indeterminate(ID)-domain 7 (.1)
AT2G02080 52 / 1e-08 C2H2ZnF ATIDD4 indeterminate(ID)-domain 4 (.1), indeterminate(ID)-domain 4 (.2)
AT1G03840 51 / 2e-08 C2H2ZnF MGP Magpie, C2H2 and C2HC zinc fingers superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023138 218 / 6e-72 AT1G34370 236 / 4e-75 sensitive to proton rhizotoxicity 1, C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
Lus10009435 95 / 9e-24 AT1G34370 506 / 4e-177 sensitive to proton rhizotoxicity 1, C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
Lus10006071 88 / 2e-21 AT1G34370 448 / 2e-154 sensitive to proton rhizotoxicity 1, C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
Lus10007168 58 / 1e-10 AT5G66730 386 / 2e-129 INDETERMINATE DOMAIN 1, ENHYDROUS, C2H2-like zinc finger protein (.1)
Lus10041723 56 / 7e-10 AT3G50700 489 / 1e-170 indeterminate(ID)-domain 2 (.1)
Lus10004497 55 / 1e-09 AT1G55110 341 / 5e-113 indeterminate(ID)-domain 7 (.1)
Lus10029904 54 / 2e-09 AT1G55110 337 / 6e-112 indeterminate(ID)-domain 7 (.1)
Lus10008396 54 / 3e-09 AT3G13810 339 / 1e-110 indeterminate(ID)-domain 11 (.1), indeterminate(ID)-domain 11 (.2), indeterminate(ID)-domain 11 (.3)
Lus10004840 53 / 4e-09 AT3G13810 337 / 1e-110 indeterminate(ID)-domain 11 (.1), indeterminate(ID)-domain 11 (.2), indeterminate(ID)-domain 11 (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G094100 115 / 7e-32 AT1G34370 236 / 3e-75 sensitive to proton rhizotoxicity 1, C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
Potri.019G085400 103 / 4e-27 AT1G34370 478 / 1e-165 sensitive to proton rhizotoxicity 1, C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
Potri.013G114600 99 / 2e-25 AT1G34370 495 / 3e-172 sensitive to proton rhizotoxicity 1, C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
Potri.004G217100 92 / 4e-23 AT5G22890 316 / 2e-105 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.014G180600 59 / 4e-11 AT3G50700 368 / 3e-123 indeterminate(ID)-domain 2 (.1)
Potri.002G263600 58 / 7e-11 AT3G50700 337 / 4e-111 indeterminate(ID)-domain 2 (.1)
Potri.005G215100 55 / 8e-10 AT1G03840 328 / 1e-107 Magpie, C2H2 and C2HC zinc fingers superfamily protein (.1.2)
Potri.006G129300 55 / 9e-10 AT5G03150 371 / 1e-123 JACKDAW, C2H2-like zinc finger protein (.1)
Potri.016G088500 55 / 9e-10 AT5G03150 353 / 1e-116 JACKDAW, C2H2-like zinc finger protein (.1)
Potri.005G027200 55 / 9e-10 AT1G03840 300 / 7e-96 Magpie, C2H2 and C2HC zinc fingers superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10011495 pacid=23182659 polypeptide=Lus10011495 locus=Lus10011495.g ID=Lus10011495.BGIv1.0 annot-version=v1.0
ATGTATACGTGCAGCCGATGCAACAAGAAGAACTTCTCGGTGGAGGCTGATTTAAGGAGCCATTTCAAGCACTGTGGGGAGTTGAGGTGGAAGTGCAATT
GTGGGACGAGCTTCTCCAGGAAGGACAAGCTGTTTGGGCACATGGCATTGTTCGAAGGTCACATGCCGGCTGCTAGGGAGGAAGAGGATGGAGGAGAAGA
GGTGAAGATGATGGTGCAGCAGGAGGAGGATGATGGGAATGGAGAGGGGTTGTTGTTTGATGATGGATTTGGTTCCATGGAGGATGTGTTGGAGTATCCT
GCTTCTCCTGATTGGCAAAGGGAGATGTCACTGTTTTGTGGGTTTGGGCAGTGA
AA sequence
>Lus10011495 pacid=23182659 polypeptide=Lus10011495 locus=Lus10011495.g ID=Lus10011495.BGIv1.0 annot-version=v1.0
MYTCSRCNKKNFSVEADLRSHFKHCGELRWKCNCGTSFSRKDKLFGHMALFEGHMPAAREEEDGGEEVKMMVQQEEDDGNGEGLLFDDGFGSMEDVLEYP
ASPDWQREMSLFCGFGQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G34370 C2H2ZnF STOP1 sensitive to proton rhizotoxic... Lus10011495 0 1
AT5G27420 CNI1, ATL31 carbon/nitrogen insensitive 1 ... Lus10043034 1.4 0.8741
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Lus10029809 2.0 0.9006
AT1G76890 Trihelix AT-GT2, GT2 Duplicated homeodomain-like su... Lus10020873 2.2 0.8638
AT3G58090 Disease resistance-responsive ... Lus10009074 2.6 0.8545
AT3G50120 Plant protein of unknown funct... Lus10009871 3.5 0.8733
AT1G66130 NAD(P)-binding Rossmann-fold s... Lus10039898 8.7 0.8656
AT4G25440 C3HZnF ZFWD1 zinc finger WD40 repeat protei... Lus10021655 9.4 0.8479
AT2G01818 PLATZ transcription factor fam... Lus10030763 10.0 0.8222
AT1G35420 alpha/beta-Hydrolases superfam... Lus10000375 10.2 0.8370
AT1G78380 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. ... Lus10026198 10.7 0.8581

Lus10011495 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.