Lus10011496 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011497 148 / 5e-47 ND /
Lus10004409 39 / 0.0001 ND 39 / 5e-04
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011496 pacid=23182622 polypeptide=Lus10011496 locus=Lus10011496.g ID=Lus10011496.BGIv1.0 annot-version=v1.0
ATGAGCTGGAGCCCTTCAAAGATGTGCTACGACCAATTAGAAATAAATTCCAACCAACCACGGGCACTTTTGCCAGAAAATGATAGTGGGACTTTGGTGT
ATCTGGAGGGAGAGGTACAACCGAGCTTGGACTGCCATACACAGTCCACCATGGTTGGTGATCAAGGATGGGGTCCAACATCTTCAAGAGTGGTTAGCAA
CAAGGGAGAAGGGCTTTTACCGTCACGGCAGGATCCCCGCTATTTCTCTAAATGGCACCCGCCGGCCATGGACACGTTCAAGTGTAATGTTGGCGTTGCT
CTCTTCACCGCTATTCGAAGGATGGGGATGGGTGTAGCACTTTCGGGACCATGCTGGTACGTTAATTCACTGTAA
AA sequence
>Lus10011496 pacid=23182622 polypeptide=Lus10011496 locus=Lus10011496.g ID=Lus10011496.BGIv1.0 annot-version=v1.0
MSWSPSKMCYDQLEINSNQPRALLPENDSGTLVYLEGEVQPSLDCHTQSTMVGDQGWGPTSSRVVSNKGEGLLPSRQDPRYFSKWHPPAMDTFKCNVGVA
LFTAIRRMGMGVALSGPCWYVNSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10011496 0 1
AT1G12570 Glucose-methanol-choline (GMC)... Lus10002957 1.4 1.0000
AT3G20760 Nse4, component of Smc5/6 DNA ... Lus10004185 2.0 1.0000
Lus10009800 2.8 1.0000
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 3.0 1.0000
Lus10011848 4.0 1.0000
Lus10011759 4.2 1.0000
AT2G28320 Pleckstrin homology (PH) and l... Lus10023522 4.2 1.0000
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10011845 4.6 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10024923 5.7 1.0000
AT4G00750 S-adenosyl-L-methionine-depend... Lus10027433 6.0 1.0000

Lus10011496 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.