Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37290 54 / 7e-11 unknown protein AT2G23270 50 / 1e-09 unknown protein AT1G49800 44 / 6e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019310 [exp] 144 / 2e-46 AT4G37290 56 / 1e-11 unknown protein Lus10010255 [exp] 89 / 2e-24 AT4G37290 54 / 6e-11 unknown protein Lus10010257 [exp] 51 / 1e-09 ND 37 / 3e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G049500 [exp] 73 / 4e-18 AT4G37290 48 / 1e-08 unknown protein Potri.016G015600 [exp] 67 / 8e-16 AT4G37290 45 / 2e-07 unknown protein Potri.005G142900 [exp] 67 / 1e-15 AT4G37290 44 / 4e-07 unknown protein Potri.006G008066 [exp] 64 / 1e-13 AT2G23270 45 / 2e-06 unknown protein Potri.007G049400 [exp] 54 / 4e-11 AT4G37290 46 / 5e-08 unknown protein Potri.001G299800 [exp] 48 / 2e-08 AT1G49800 44 / 1e-06 unknown protein Potri.006G008132 [exp] 48 / 5e-08 ND / Potri.009G095600 [exp] 44 / 5e-07 AT1G49800 / unknown protein Potri.001G299900 [exp] 40 / 3e-05 AT1G49800 48 / 2e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011512 pacid=23140441 polypeptide=Lus10011512 locus=Lus10011512.g ID=Lus10011512.BGIv1.0 annot-version=v1.0 ATGGCAGGCGGGTTCAGATCGGTTCGGTTCGCAGCCATCGCTCTATTGTTGGTCTCTGTCGTTCTTCTGATTTCTGGAGCCGTAGCGGGTCGGCCGTTAA ACATATTGAACACGGAGGCAGCTGTGGCGATGGACCGGTTCTTGGATGGGTTAGCTTTGGGTGCGATCAAGGAATCGGGACCGAGTCCAGGAGTGGGTCA CTCGTTCACCGACACCGTCAACTCGTTGGGAGGAAGAAAGAACTCCGGGCCGAGTCCCGGAGTGGGTCACCAGTTTGTCACCGGTACCCGCCAATGA
AA sequence Show only first row Show all	>Lus10011512 pacid=23140441 polypeptide=Lus10011512 locus=Lus10011512.g ID=Lus10011512.BGIv1.0 annot-version=v1.0 MAGGFRSVRFAAIALLLVSVVLLISGAVAGRPLNILNTEAAVAMDRFLDGLALGAIKESGPSPGVGHSFTDTVNSLGGRKNSGPSPGVGHQFVTGTRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37290			unknown protein		Lus10011512 [exp]	0	1
AT1G13110		CYP71B7	"cytochrome P450, family 71 su...		Lus10029035 [exp]	11.6	0.9674
AT2G43840		UGT74F1	UDP-glycosyltransferase 74 F1 ...		Lus10014148 [exp]	12.4	0.9671
AT5G04500			glycosyltransferase family pro...		Lus10037920 [exp]	13.7	0.9333
AT5G10530			Concanavalin A-like lectin pro...		Lus10020456 [exp]	14.1	0.9666
AT5G49480		ACP1, ATCP1	Ca2+-binding protein 1, Ca2+-b...		Lus10017063 [exp]	18.9	0.9666
AT5G10530			Concanavalin A-like lectin pro...		Lus10007079 [exp]	21.9	0.9529
AT5G45860		RCAR5, PYL11	regulatory components of ABA r...		Lus10003187 [exp]	22.4	0.9634
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10022191 [exp]	22.5	0.9606
AT3G26320		CYP71B36	"cytochrome P450, family 71, s...		Lus10016601 [exp]	23.0	0.9523
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10031100 [exp]	25.2	0.9658

Compare expression of checked genes

Lus10011512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.