Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23090 132 / 2e-42 Uncharacterised protein family SERF (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019287 [exp] 164 / 5e-55 AT2G23090 134 / 5e-43 Uncharacterised protein family SERF (.1) Lus10014734 [exp] 56 / 3e-11 AT2G23090 54 / 1e-10 Uncharacterised protein family SERF (.1) Lus10002728 [exp] 57 / 5e-11 AT2G24990 681 / 0.0 Serine/threonine-protein kinase Rio1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G120100 [exp] 140 / 1e-45 AT2G23090 141 / 7e-46 Uncharacterised protein family SERF (.1) Potri.014G018100 [exp] 136 / 5e-44 AT2G23090 139 / 5e-45 Uncharacterised protein family SERF (.1) Potri.001G296600 [exp] 128 / 8e-41 AT2G23090 129 / 5e-41 Uncharacterised protein family SERF (.1) Potri.009G090800 [exp] 115 / 1e-35 AT2G23090 118 / 7e-37 Uncharacterised protein family SERF (.1) Potri.014G018400 [exp] 61 / 2e-14 AT2G23090 62 / 1e-14 Uncharacterised protein family SERF (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04419 [flax] [poplar] 4F5 4F5 protein related disordered region
Representative CDS sequence Show only first row Show all	>Lus10011535 pacid=23140384 polypeptide=Lus10011535 locus=Lus10011535.g ID=Lus10011535.BGIv1.0 annot-version=v1.0 ATGGGAGGAGGCAATGCCCAGAAGGCCAAGATGGCTCGCGACAGGAACTTGGAGAAGAAAGCTGGCTCCTCCAAGGGAAGCCAGCTGGATACCAACAAGA AAGCTATGAACATCCAGTGCAAGGTTTGTATGCAGACATTCATGTGCACAACATCAGAGGTGAAGTGCAGGGAACACGCAGAAGCGAAGCACCCGAAATC GGATGTTTACGTTTGCTTCCCTCATCTCAAACCTCAATAA
AA sequence Show only first row Show all	>Lus10011535 pacid=23140384 polypeptide=Lus10011535 locus=Lus10011535.g ID=Lus10011535.BGIv1.0 annot-version=v1.0 MGGGNAQKAKMARDRNLEKKAGSSKGSQLDTNKKAMNIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDVYVCFPHLKPQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23090			Uncharacterised protein family...		Lus10011535 [exp]	0	1
AT1G50670			OTU-like cysteine protease fam...		Lus10040075 [exp]	5.7	0.8449
AT4G20330			Transcription initiation facto...		Lus10029563 [exp]	7.6	0.8493
AT1G19270		DA1	DA1 (.1)		Lus10032736 [exp]	8.1	0.8065
AT2G38900			Serine protease inhibitor, pot...		Lus10035626 [exp]	8.1	0.8532
AT4G22590		TPPG	trehalose-6-phosphate phosphat...		Lus10024607 [exp]	10.5	0.8165
AT5G02790		GSTL3	Glutathione transferase L3, Gl...		Lus10003994 [exp]	11.2	0.8408
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10024071 [exp]	12.0	0.8434
AT1G53580		GLY3, GLX2-3, E...	GLYOXALASE 2-3, ETHE1-LIKE, gl...		Lus10020760 [exp]	12.0	0.8288
AT3G29130			unknown protein		Lus10000252 [exp]	16.2	0.7749
AT1G43900			Protein phosphatase 2C family ...		Lus10042775 [exp]	18.0	0.7916

Compare expression of checked genes

Lus10011535 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.