Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49910 115 / 2e-34 Translation protein SH3-like family protein (.1) AT5G67510 110 / 1e-32 Translation protein SH3-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019283 [exp] 125 / 6e-39 AT3G49910 212 / 1e-72 Translation protein SH3-like family protein (.1) Lus10028537 [exp] 125 / 2e-38 AT3G49910 262 / 1e-91 Translation protein SH3-like family protein (.1) Lus10018139 [exp] 125 / 2e-38 AT3G49910 262 / 1e-91 Translation protein SH3-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G085200 [exp] 117 / 4e-35 AT3G49910 241 / 3e-83 Translation protein SH3-like family protein (.1) Potri.007G055900 [exp] 115 / 1e-34 AT3G49910 236 / 2e-81 Translation protein SH3-like family protein (.1) Potri.005G082600 [exp] 114 / 7e-34 AT3G49910 214 / 2e-72 Translation protein SH3-like family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0107 [flax] [poplar] KOW PF00467 [flax] [poplar] KOW KOW motif
Representative CDS sequence Show only first row Show all	>Lus10011540 pacid=23140411 polypeptide=Lus10011540 locus=Lus10011540.g ID=Lus10011540.BGIv1.0 annot-version=v1.0 ATGCCGGTCCGCAAGGACGACGAGGTGCAGGTCGTCAGGGGAACTTTCAAGGGCCGCGAGGGGAAAGTCGTGCAGGTTTACCGCCGGAAGTGGGTGATCC ACATCGAGCGCATCACTAGGGAGAAGGTGAACGGATCCACCGTCAATGTCGGCATCCACCCTTCCAAGGTCGTCGTCACCAAGCTCCGTCTTGACAAAGA TCGCAAGTCGCTGCTCGACCGCAAGGCTAAAGGACGCGCTGCTGCTGATAAGGAGAAGGGTGCCGCTGAGGATATTATGCAGAACGTCGATTGA
AA sequence Show only first row Show all	>Lus10011540 pacid=23140411 polypeptide=Lus10011540 locus=Lus10011540.g ID=Lus10011540.BGIv1.0 annot-version=v1.0 MPVRKDDEVQVVRGTFKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGIHPSKVVVTKLRLDKDRKSLLDRKAKGRAAADKEKGAAEDIMQNVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49910			Translation protein SH3-like f...		Lus10011540 [exp]	0	1
AT3G49910			Translation protein SH3-like f...		Lus10028537 [exp]	1.7	0.9578
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Lus10004113 [exp]	2.4	0.9192
AT5G02850			hydroxyproline-rich glycoprote...		Lus10002749 [exp]	3.3	0.8821
AT4G39880			Ribosomal protein L23/L15e fam...		Lus10024048 [exp]	3.6	0.8768
AT2G40290			Eukaryotic translation initiat...		Lus10007521 [exp]	3.7	0.9086
AT3G19120			PIF / Ping-Pong family of plan...		Lus10025271 [exp]	4.7	0.8659
AT1G20300			Pentatricopeptide repeat (PPR)...		Lus10037533 [exp]	4.9	0.9062
AT5G43970		ATTOM22-V, TOM2...	TRANSLOCASE OUTER MITOCHONDRIA...		Lus10022876 [exp]	4.9	0.9112
AT1G23290		RPL27A, RPL27AB	RIBOSOMAL PROTEIN L27A, Riboso...		Lus10016336 [exp]	6.9	0.9137
AT5G48760			Ribosomal protein L13 family p...		Lus10007137 [exp]	9.2	0.9123

Compare expression of checked genes

Lus10011540 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.