Lus10011552 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019268 93 / 5e-24 AT5G67640 72 / 1e-14 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011552 pacid=23140420 polypeptide=Lus10011552 locus=Lus10011552.g ID=Lus10011552.BGIv1.0 annot-version=v1.0
ATGAGCGGCTCGTCGTCCTCGGCGAGCGACACGGATGGAGGCAGTCGGAAGTTGAGTAGGGCTCAAAGGAAGAGGCCGAGGAAGAAGAGGATTAAGGAGG
ATGCTTGCTGTCGGAAGGAGATAATTGGGCCGTTGCTACCACCAGCTGGTGCTGGAGAAGGAGAGTGCAGTCGAGGTGTTCGACAAAATGCCGATGAGAC
TGGCCAAGGCAGCAATGATGCAGGTGTTGGTGCGAGCAGGATGAACCAGCGTAGGAAGGCAAAGAAGCTGGCCAAGGAGAAGCTGAAACCAGACATGATC
AAGGTGTCGGCTGATGATGAGAAATGTTAA
AA sequence
>Lus10011552 pacid=23140420 polypeptide=Lus10011552 locus=Lus10011552.g ID=Lus10011552.BGIv1.0 annot-version=v1.0
MSGSSSSASDTDGGSRKLSRAQRKRPRKKRIKEDACCRKEIIGPLLPPAGAGEGECSRGVRQNADETGQGSNDAGVGASRMNQRRKAKKLAKEKLKPDMI
KVSADDEKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G67640 unknown protein Lus10011552 0 1
Lus10011553 1.0 0.9633
AT5G10530 Concanavalin A-like lectin pro... Lus10029555 4.0 0.9297
AT1G30190 unknown protein Lus10023301 4.5 0.9357
Lus10031407 7.7 0.9327
AT3G57330 ACA11 autoinhibited Ca2+-ATPase 11, ... Lus10042040 8.0 0.9347
AT2G46600 Calcium-binding EF-hand family... Lus10005985 8.5 0.9353
AT2G19330 PIRL6 plant intracellular ras group-... Lus10003229 9.1 0.8940
AT2G46600 Calcium-binding EF-hand family... Lus10030227 12.0 0.9320
Lus10031026 12.4 0.9209
AT2G38170 RCI4, ATCAX1, C... RARE COLD INDUCIBLE 4, cation ... Lus10040674 17.5 0.9140

Lus10011552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.