Plant FIBer expression Database

Lus10011555 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37710 47 / 2e-07 VQ motif-containing protein (.1)
AT2G22880 41 / 5e-05 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019270
[exp]
159 / 2e-50 AT4G37710 47 / 4e-07 VQ motif-containing protein (.1)
Lus10039654
[exp]
51 / 4e-08 ND 41 / 1e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G006400
[exp]
46 / 1e-06 AT4G37710 / VQ motif-containing protein (.1)
Potri.007G006200
[exp]
45 / 3e-06 AT4G37710 / VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10011555 pacid=23140432 polypeptide=Lus10011555 locus=Lus10011555.g ID=Lus10011555.BGIv1.0 annot-version=v1.0
ATGGAAGCCAACTCATCATCGTCATCCGCCACGTCATCGATGAACCGGCCGAGCAAGAGGAAGCTACACACGGCCCCCTTGCCACCTAATCCCCCGAGGG
TCTACAAGGTCGACCCGGTCAACTTCCGGGACCTCGTCCAACGTCTGACCGGTTCGATCTCTGAGGAGGCTCCTTCTCAACGGCCGAGGATGCAGAGCTT
GGCTCCTCCACCGCTCGAGGAGCAGCAACTCCTTCCGTCCAGGATGGAGGGGAGTAATAATGGAAATGATGCTCCGTCGCCGTTGACGGCAATGTGTAGG
GAGCTGATGATGGACGATGATCAGGTGGCGGGGATCGAAATGCGACCTTCTTCTTCTTCGTCGTTGGAGCTGAATCTTTCGTCGGCGGCGAAGGCGGTTG
ATTCGTCGCAGTATTGGTATCCTCAGATGTTGAGTAATCGTGGGAGCTTGTGA
AA sequence
>Lus10011555 pacid=23140432 polypeptide=Lus10011555 locus=Lus10011555.g ID=Lus10011555.BGIv1.0 annot-version=v1.0
MEANSSSSSATSSMNRPSKRKLHTAPLPPNPPRVYKVDPVNFRDLVQRLTGSISEEAPSQRPRMQSLAPPPLEEQQLLPSRMEGSNNGNDAPSPLTAMCR
ELMMDDDQVAGIEMRPSSSSSLELNLSSAAKAVDSSQYWYPQMLSNRGSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37710 VQ motif-containing protein (.... Lus10011555
[exp]
0 1
AT4G31970 CYP82C2, JAH1 "cytochrome P450, family 82, s... Lus10025923
[exp]
1.0 0.9522
AT1G11050 Protein kinase superfamily pro... Lus10028553
[exp]
2.0 0.9489
AT2G44450 BGLU15 beta glucosidase 15 (.1) Lus10031235
[exp]
4.9 0.9453
AT1G11050 Protein kinase superfamily pro... Lus10028554
[exp]
5.5 0.9316
AT5G51950 Glucose-methanol-choline (GMC)... Lus10015012
[exp]
5.7 0.9392
AT2G41480 Peroxidase superfamily protein... Lus10020422
[exp]
8.4 0.9226
AT2G27690 CYP94C1 "cytochrome P450, family 94, s... Lus10043378
[exp]
9.0 0.9084
AT2G33420 Protein of unknown function (D... Lus10011785
[exp]
10.2 0.9313
AT3G50470 MLA10, HR3 INTRACELLULAR MILDEW A 10, hom... Lus10009328
[exp]
11.0 0.9214
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011986
[exp]
12.0 0.9234

Lus10011555 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.