Lus10011557 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49760 50 / 3e-08 bZIP ATBZIP5 basic leucine-zipper 5 (.1)
AT2G22850 39 / 0.0003 bZIP ATBZIP6 basic leucine-zipper 6 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019273 166 / 2e-53 AT2G22850 94 / 2e-23 basic leucine-zipper 6 (.1.2)
Lus10011722 94 / 1e-24 AT3G49760 120 / 2e-34 basic leucine-zipper 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G007100 97 / 3e-26 AT3G49760 120 / 6e-35 basic leucine-zipper 5 (.1)
Potri.007G006900 86 / 2e-21 AT2G22850 118 / 1e-32 basic leucine-zipper 6 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0018 bZIP PF07716 bZIP_2 Basic region leucine zipper
Representative CDS sequence
>Lus10011557 pacid=23140395 polypeptide=Lus10011557 locus=Lus10011557.g ID=Lus10011557.BGIv1.0 annot-version=v1.0
ATGGGGCCCGTGCCATCGATGATTGAGGAGCGAAAGAGGAGGAGGATGGTATCGAACAGGGAATCTGCGAGGAGGTCTAGGATGAGAAAACGAAAACACT
TAGAGAACCTAAGGAACAGGGTGAACCGGCTTCGGGTCGAGAACCAAGAACTGACCGACCGGGTCCGGTTTGTGTCGTACCATTTGAACCGGGTACGGAC
AAACACGGACCGGCTCCGGTCCGAACACATCATGCTCCGCCGGAAACTCTCAAACGTTGGCCACATATTGATGCTCCGCCAGCTTTCCTCCGCCTCCTCC
ACTGCATGGCCATGCAATAACATGATATTCCCCGCCGTCCCCTCCGCCGCTACGGCTGAACAAATCCCATCGCTAATCACTTCATAA
AA sequence
>Lus10011557 pacid=23140395 polypeptide=Lus10011557 locus=Lus10011557.g ID=Lus10011557.BGIv1.0 annot-version=v1.0
MGPVPSMIEERKRRRMVSNRESARRSRMRKRKHLENLRNRVNRLRVENQELTDRVRFVSYHLNRVRTNTDRLRSEHIMLRRKLSNVGHILMLRQLSSASS
TAWPCNNMIFPAVPSAATAEQIPSLITS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49760 bZIP ATBZIP5 basic leucine-zipper 5 (.1) Lus10011557 0 1
AT2G19460 Protein of unknown function (D... Lus10006019 1.4 0.8268
AT3G48180 unknown protein Lus10030823 4.9 0.7802
AT4G39660 AGT2 alanine:glyoxylate aminotransf... Lus10029922 6.2 0.8180
AT1G19090 CRK1, RKF2 CYSTEINE-RICH RLK \(RECEPTOR-L... Lus10020927 8.7 0.7782
AT5G60660 PIP2F, PIP2;4 plasma membrane intrinsic prot... Lus10015083 14.3 0.7970
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10018711 20.1 0.7760
AT2G37170 PIP2;2, PIP2B PLASMA MEMBRANE INTRINSIC PROT... Lus10019934 21.5 0.7711
AT5G38660 APE1 acclimation of photosynthesis ... Lus10003077 29.4 0.7868
AT5G39570 unknown protein Lus10029322 33.2 0.7408
AT3G57040 ATRR4, ARR9 RESPONSE REGULATOR 4, response... Lus10002750 41.4 0.8088

Lus10011557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.