Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37830 86 / 5e-23 cytochrome c oxidase-related (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019250 [exp] 128 / 2e-39 AT4G37830 117 / 4e-35 cytochrome c oxidase-related (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G008800 [exp] 81 / 4e-21 AT4G37830 89 / 4e-24 cytochrome c oxidase-related (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02046 [flax] [poplar] COX6A Cytochrome c oxidase subunit VIa
Representative CDS sequence Show only first row Show all	>Lus10011574 pacid=23140413 polypeptide=Lus10011574 locus=Lus10011574.g ID=Lus10011574.BGIv1.0 annot-version=v1.0 ATGTCGTCGGCGGCGATTCTGCGATCTTCCGTTCTTCGAAGCGCTATTCGTGGCGGCTCAAAGGCCTCCGCTCCGGCCAAGCGCCAATTCTCTGCCTCCG CTCATCAGGATGTTGAATTCGAGGCCAAAGAAGCAGCCAAGTGGGAGAAGATCACCTATCTCGGAGCTGCGACTTGTACCGCACTAGCTACCTACTGCTT GTCGAAGGGACACCCTCACTCAGAAGAGCCACCGGCATACCCCTATCTCCATATCCGCAATAAGGAGTTCCCATGGGGACCGGATGGGCTGTTCGAGGTG AAAGAGCACCACTGA
AA sequence Show only first row Show all	>Lus10011574 pacid=23140413 polypeptide=Lus10011574 locus=Lus10011574.g ID=Lus10011574.BGIv1.0 annot-version=v1.0 MSSAAILRSSVLRSAIRGGSKASAPAKRQFSASAHQDVEFEAKEAAKWEKITYLGAATCTALATYCLSKGHPHSEEPPAYPYLHIRNKEFPWGPDGLFEV KEHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37830			cytochrome c oxidase-related (...		Lus10011574 [exp]	0	1
AT5G09570			Cox19-like CHCH family protein...		Lus10007086 [exp]	1.0	0.8991
AT2G20940			Protein of unknown function (D...		Lus10025069 [exp]	3.5	0.8888
AT1G08480		SDH6	succinate dehydrogenase 6, unk...		Lus10013373 [exp]	4.2	0.8847
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Lus10033937 [exp]	9.9	0.8397
AT1G19580		GAMMACA1 ,GAMMA...	gamma carbonic anhydrase 1 (.1...		Lus10024267 [exp]	10.8	0.8590
AT4G30010			unknown protein		Lus10015329 [exp]	13.4	0.8484
AT2G42310			unknown protein		Lus10042351 [exp]	16.5	0.8148
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10031982 [exp]	20.3	0.8356
AT1G15230			unknown protein		Lus10025791 [exp]	23.2	0.7704
AT1G08700		PS1	Presenilin-1 (.1)		Lus10020339 [exp]	23.5	0.8279

Compare expression of checked genes

Lus10011574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.