Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010234 [exp] 100 / 2e-27 ND / Lus10012486 [exp] 92 / 2e-24 ND / Lus10038705 [exp] 89 / 8e-23 ND / Lus10036283 [exp] 87 / 8e-23 ND / Lus10010830 [exp] 87 / 1e-22 ND / Lus10033073 [exp] 84 / 3e-21 ND / Lus10028088 [exp] 74 / 2e-18 ND / Lus10034823 [exp] 75 / 3e-18 AT4G15733 66 / 7e-15 SCR-like 11 (.1) Lus10034824 [exp] 75 / 3e-18 AT4G15733 63 / 9e-14 SCR-like 11 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011594 pacid=23142772 polypeptide=Lus10011594 locus=Lus10011594.g ID=Lus10011594.BGIv1.0 annot-version=v1.0 ATGGAAACTGGAGCACAAGGTTTGCACCATCCCGAAGGTGTGACCAAGGCTACTAAGTACTGGAACAAGCTCCACCGCTTCCTCAACTACATGATTTCCC ACTCCATCACGGGTCGAACGGAGTGCAAAGAAGCTGTCACCCTCCGTGTGCTTGCTCTATTATATGCATCCGTGGCTATGGAGCCGATCCACCTTGGGAA CCTCTTGGTTCTCACCCTCCGGACTATTGGCTTCAAACCTACTCTGAAGGTCCTCCCATGTGGTGCCGACATCATCAATACGACTGCCTTGCTGATAATG CAGATGTTGCGAAGGATCCACTATGGCGGCTAG
AA sequence Show only first row Show all	>Lus10011594 pacid=23142772 polypeptide=Lus10011594 locus=Lus10011594.g ID=Lus10011594.BGIv1.0 annot-version=v1.0 METGAQGLHHPEGVTKATKYWNKLHRFLNYMISHSITGRTECKEAVTLRVLALLYASVAMEPIHLGNLLVLTLRTIGFKPTLKVLPCGADIINTTALLIM QMLRRIHYGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011594 [exp]	0	1
					Lus10000325 [exp]	1.7	1.0000
					Lus10002099 [exp]	2.8	1.0000
AT2G46760			D-arabinono-1,4-lactone oxidas...		Lus10004735 [exp]	3.0	1.0000
					Lus10025316 [exp]	3.9	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005495 [exp]	4.0	1.0000
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10030510 [exp]	4.2	1.0000
AT5G39200			unknown protein		Lus10030710 [exp]	4.6	1.0000
					Lus10032121 [exp]	5.5	1.0000
AT1G64660		ATMGL	methionine gamma-lyase (.1)		Lus10033233 [exp]	5.7	1.0000
AT4G20800			FAD-binding Berberine family p...		Lus10006507 [exp]	6.0	1.0000

Compare expression of checked genes

Lus10011594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.