Lus10011597 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65730 463 / 1e-166 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G37800 457 / 3e-164 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT5G13870 308 / 2e-105 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT2G06850 298 / 3e-101 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT4G03210 284 / 8e-96 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT5G57530 276 / 7e-93 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57560 274 / 7e-92 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25820 273 / 2e-91 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT1G11545 273 / 2e-91 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
AT5G57540 273 / 2e-91 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039643 564 / 0 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10040121 306 / 4e-104 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10030923 305 / 4e-104 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10003022 304 / 2e-103 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10011052 302 / 2e-102 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10039715 296 / 2e-100 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10018503 295 / 4e-100 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10035654 291 / 3e-98 AT2G14620 437 / 6e-156 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Lus10031586 283 / 2e-95 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G008500 486 / 2e-175 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.014G140300 308 / 2e-105 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.001G071000 308 / 4e-105 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.003G159700 306 / 2e-104 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.009G083800 292 / 8e-99 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Potri.014G146100 285 / 5e-96 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201200 284 / 9e-96 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G244200 284 / 1e-95 AT4G13090 321 / 3e-110 xyloglucan endotransglucosylase/hydrolase 2 (.1)
Potri.005G201250 282 / 6e-95 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 280 / 4e-94 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10011597 pacid=23142762 polypeptide=Lus10011597 locus=Lus10011597.g ID=Lus10011597.BGIv1.0 annot-version=v1.0
ATGAGCACAAGTGCCGTAATTTGCATTGCTGTTGTTATTGTAGTGGCTTTTGCTTCTGCTCCCATATTAGTCTCTTCCCGCCCCACCACTTTCTTGCAAG
ACTTCAAGGTCACCTGGGGTGATTCCCACGTCCGACAGCTTGACGGCGGCCGAGCCATTCAGCTCCTCCTCGACCAAAACTCAGGATGTGGGTTTGCTTC
CAAGAGGAAGTACTTGTTCGGACAGGTCAGCATGAGGATCAAGCTCGTCCCTGGAGATTCCGCTGGAACTGTTACTGCTTTCTATCTGAACTCTGACACC
AACGAAATTAGAGATGAGCTGGACTTCGAGTTTCTGGGGAACAGGAGCGGGCAGCCTTACACGGTTCAAACCAACATATTTGCTCACGGAAAGGGAGACA
AAGAACAAAGGGTCAACCTCTGGTTCGACCCATCTGCAGATTTCCACCTCTACCGTATCCGCTGGAGCCACTCCCAGATTGTGTATTACGTAGATGATGT
GCCAGTGAGGGTATTCAAGAACAACGAAGCGAAAGGAGTGGGGTACCCAAAGTCACAGCCAATGGGAGTGTACTCGACGTTGTGGGAGGCAGATGACTGG
GCAACGAGAGGAGGATTGGAGAAGATTAATTGGAGCAAAGCTCCATTCATGGCCCACTACAAGGACTTTGACATTGAAGGTTGTCCAGTCCCAGGACCCT
CCACTTGTGCTTCCAACCCTAGTAATTGGTGGGAAGGCGCAAGTTACAAAGGACTCACTCCACTTGAAGCTAGAAAATACAGGTGGGTTCGCATGAACCA
CATGATCTACGACTATTGCACCGACAAATCCCGCTTCCCCGTCCCTCCCACTGAGTGTACCGCCGGCCTCTTCTGA
AA sequence
>Lus10011597 pacid=23142762 polypeptide=Lus10011597 locus=Lus10011597.g ID=Lus10011597.BGIv1.0 annot-version=v1.0
MSTSAVICIAVVIVVAFASAPILVSSRPTTFLQDFKVTWGDSHVRQLDGGRAIQLLLDQNSGCGFASKRKYLFGQVSMRIKLVPGDSAGTVTAFYLNSDT
NEIRDELDFEFLGNRSGQPYTVQTNIFAHGKGDKEQRVNLWFDPSADFHLYRIRWSHSQIVYYVDDVPVRVFKNNEAKGVGYPKSQPMGVYSTLWEADDW
ATRGGLEKINWSKAPFMAHYKDFDIEGCPVPGPSTCASNPSNWWEGASYKGLTPLEARKYRWVRMNHMIYDYCTDKSRFPVPPTECTAGLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G65730 XTH6, XTR10 xyloglucan endotransglucosylas... Lus10011597 0 1
AT5G65730 XTH6, XTR10 xyloglucan endotransglucosylas... Lus10039643 1.4 0.9569
AT5G25840 Protein of unknown function (D... Lus10011427 2.8 0.9212
Lus10016101 3.0 0.8829
AT1G78955 CAMS1 camelliol C synthase 1 (.1) Lus10016441 3.2 0.9550
AT1G78950 ATLUP3 Terpenoid cyclases family prot... Lus10016440 4.2 0.9443
Lus10016100 5.0 0.9148
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10023027 6.0 0.8280
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Lus10006759 7.1 0.8804
Lus10023767 7.3 0.8530
AT1G09790 COBL6 COBRA-like protein 6 precursor... Lus10007217 8.0 0.8631

Lus10011597 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.