Lus10011601 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G13980 46 / 4e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT4G29090 42 / 2e-05 Ribonuclease H-like superfamily protein (.1)
AT3G25270 40 / 5e-05 Ribonuclease H-like superfamily protein (.1)
AT4G09775 39 / 0.0001 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004409 64 / 5e-14 ND 39 / 5e-04
Lus10039942 54 / 3e-10 AT2G34320 45 / 7e-06 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10009101 49 / 1e-08 ND 35 / 0.003
Lus10043127 49 / 5e-08 AT5G46740 362 / 2e-115 ubiquitin-specific protease 21 (.1)
Lus10022194 38 / 0.0006 AT3G21540 76 / 8e-15 transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10011601 pacid=23142769 polypeptide=Lus10011601 locus=Lus10011601.g ID=Lus10011601.BGIv1.0 annot-version=v1.0
ATGAACGGATGCAAGAAGTGGCATCGTCCGCCGGAAGGGGTGCTGAAATTGAATGTCGATGCCGCTTTCTTCCCGGACCGTTCTTGCTCCGGAGTGTGCA
GGGTGCTGCGGGGTCGAGTTGGACAAGTGATGAGATATAAACATATTCTTTTTGATGGCGTCCCCGGTACAAAGGAAGGAGAGGCGAAGGCAATATTGGC
AGGTATGAAGTGGGCAGCGGAGATGGATTATTCAAATATCATTCTTGAAGCTGATTGTCAAATGGTCGGAGAGCAATTGCGGGAGAGATTTCAGATGTTA
TAA
AA sequence
>Lus10011601 pacid=23142769 polypeptide=Lus10011601 locus=Lus10011601.g ID=Lus10011601.BGIv1.0 annot-version=v1.0
MNGCKKWHRPPEGVLKLNVDAAFFPDRSCSGVCRVLRGRVGQVMRYKHILFDGVPGTKEGEAKAILAGMKWAAEMDYSNIILEADCQMVGEQLRERFQML

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G13980 Polynucleotidyl transferase, r... Lus10011601 0 1
AT5G17540 HXXXD-type acyl-transferase fa... Lus10020333 3.5 0.8348
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10017676 6.2 0.7232
AT2G31180 MYB ATMYB14, Myb14a... ARABIDOPSIS THALIANA MYB DOMAI... Lus10022021 8.2 0.8119
AT4G01575 serine protease inhibitor, Kaz... Lus10009865 8.6 0.6419
AT3G02100 UDP-Glycosyltransferase superf... Lus10003456 10.1 0.8119
AT4G29340 PRF4 profilin 4 (.1) Lus10012935 11.7 0.8119
AT2G04810 Protein of unknown function (D... Lus10020538 13.0 0.8087
AT5G50960 ATNBP35, NBP35 nucleotide binding protein 35 ... Lus10036588 13.4 0.7367
AT3G09290 C2H2ZnF TAC1 telomerase activator1 (.1) Lus10021213 14.3 0.8069
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10006697 15.9 0.7511

Lus10011601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.