Plant FIBer expression Database

Lus10011608 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32900 89 / 4e-24 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1), Peptidyl-tRNA hydrolase II (PTH2) family protein (.2)
AT3G03010 52 / 6e-10 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1), Peptidyl-tRNA hydrolase II (PTH2) family protein (.2)
AT5G16870 47 / 5e-08 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009246
[exp]
49 / 1e-08 AT5G16870 259 / 8e-90 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G237900
[exp]
91 / 6e-25 AT4G32900 238 / 1e-80 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1), Peptidyl-tRNA hydrolase II (PTH2) family protein (.2)
Potri.019G050100
[exp]
50 / 3e-09 AT5G16870 259 / 2e-89 Peptidyl-tRNA hydrolase II (PTH2) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0305 PTH2 PF01981 PTH2 Peptidyl-tRNA hydrolase PTH2
Representative CDS sequence
>Lus10011608 pacid=23150923 polypeptide=Lus10011608 locus=Lus10011608.g ID=Lus10011608.BGIv1.0 annot-version=v1.0
ATGGGTACAGGAAAGATTGCCTTTCAGTGTGCTCATGCATCCACTGGCATGTACTCAGAGCTGATGCAAAGTGATCGTTCACTCTTGAGACGATGGGAAC
AATGTGGGCAGGTTTCAGCTGGATCAAAGACCGTAATGGCGGTTGGTCCTGGTTCAAAATCATCTATGGATTCAGTTACGGGAAAACTACGCCTTCTCTG
A
AA sequence
>Lus10011608 pacid=23150923 polypeptide=Lus10011608 locus=Lus10011608.g ID=Lus10011608.BGIv1.0 annot-version=v1.0
MGTGKIAFQCAHASTGMYSELMQSDRSLLRRWEQCGQVSAGSKTVMAVGPGSKSSMDSVTGKLRLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32900 Peptidyl-tRNA hydrolase II (PT... Lus10011608
[exp]
0 1
AT2G16630 Pollen Ole e 1 allergen and ex... Lus10042394
[exp]
1.0 0.9702
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10022760
[exp]
2.0 0.9563
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10025104
[exp]
3.0 0.9462
Lus10024490
[exp]
3.5 0.9340
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10016495
[exp]
4.9 0.9066
Lus10029087
[exp]
5.0 0.9136
AT1G73110 P-loop containing nucleoside t... Lus10024092
[exp]
12.1 0.9069
AT5G46090 Protein of unknown function (D... Lus10018635
[exp]
12.7 0.9106
Lus10030536
[exp]
15.9 0.7594
Lus10007244
[exp]
18.7 0.8141

Lus10011608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.