Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30030 65 / 6e-14 Eukaryotic aspartyl protease family protein (.1) AT4G30040 64 / 2e-13 Eukaryotic aspartyl protease family protein (.1) AT2G23945 62 / 6e-13 Eukaryotic aspartyl protease family protein (.1) AT2G35615 60 / 5e-12 Eukaryotic aspartyl protease family protein (.1) AT1G64830 57 / 5e-11 Eukaryotic aspartyl protease family protein (.1) AT1G31450 56 / 1e-10 Eukaryotic aspartyl protease family protein (.1) AT5G33340 55 / 2e-10 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) AT2G03200 53 / 1e-09 Eukaryotic aspartyl protease family protein (.1) AT3G25700 52 / 3e-09 Eukaryotic aspartyl protease family protein (.1.2) AT3G42550 50 / 2e-08 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023451 [exp] 128 / 9e-37 AT2G23945 232 / 2e-71 Eukaryotic aspartyl protease family protein (.1) Lus10031450 [exp] 123 / 7e-35 AT4G30030 231 / 2e-71 Eukaryotic aspartyl protease family protein (.1) Lus10031449 [exp] 122 / 1e-34 AT2G23945 219 / 3e-66 Eukaryotic aspartyl protease family protein (.1) Lus10011615 [exp] 119 / 2e-33 AT2G23945 224 / 5e-68 Eukaryotic aspartyl protease family protein (.1) Lus10002276 [exp] 92 / 1e-23 AT2G23945 206 / 2e-61 Eukaryotic aspartyl protease family protein (.1) Lus10015487 [exp] 91 / 4e-23 AT2G23945 214 / 7e-65 Eukaryotic aspartyl protease family protein (.1) Lus10019960 [exp] 87 / 1e-21 AT2G23945 256 / 5e-81 Eukaryotic aspartyl protease family protein (.1) Lus10015486 [exp] 87 / 1e-21 AT2G23945 248 / 3e-76 Eukaryotic aspartyl protease family protein (.1) Lus10011273 [exp] 80 / 6e-20 AT4G30040 115 / 3e-30 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G106500 [exp] 78 / 1e-18 AT4G30030 150 / 2e-41 Eukaryotic aspartyl protease family protein (.1) Potri.006G179500 [exp] 67 / 1e-14 AT2G23945 412 / 3e-141 Eukaryotic aspartyl protease family protein (.1) Potri.005G063000 [exp] 49 / 5e-08 AT3G20015 560 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.018G014800 [exp] 48 / 6e-08 AT5G10770 312 / 9e-102 Eukaryotic aspartyl protease family protein (.1) Potri.007G106300 [exp] 48 / 7e-08 AT3G20015 575 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.003G087900 [exp] 48 / 8e-08 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.005G204600 [exp] 47 / 2e-07 AT3G59080 686 / 0.0 Eukaryotic aspartyl protease family protein (.1.2) Potri.003G105300 [exp] 47 / 2e-07 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1) Potri.019G002100 [exp] 46 / 2e-07 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.010G128200 [exp] 46 / 3e-07 AT1G25510 622 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [flax] [poplar] Peptidase_AA PF00026 [flax] [poplar] Asp Eukaryotic aspartyl protease
Representative CDS sequence Show only first row Show all	>Lus10011611 pacid=23150920 polypeptide=Lus10011611 locus=Lus10011611.g ID=Lus10011611.BGIv1.0 annot-version=v1.0 ATGGGGATCCAGGTCAAGTTGGTTGAGGCCATGTATCGCAGCGGATTCTACGTGAACGTTTCAATCGGGAATCCACCAGTGCCACAACTCGCCGTTATGG ACACCGGAAGCGACTTCTTGTGGGTGAAATGTCTTCCGTGCAGTTCTTGCCAGCCGGTGAAGGGTCTCACCTACTTTGATCTGTCCAAGTCGACGACTTT CTTCCCACGGCCGTGTACCAAAGATTGCCAAAAATGCTATGGTAAGAAAATGTAA
AA sequence Show only first row Show all	>Lus10011611 pacid=23150920 polypeptide=Lus10011611 locus=Lus10011611.g ID=Lus10011611.BGIv1.0 annot-version=v1.0 MGIQVKLVEAMYRSGFYVNVSIGNPPVPQLAVMDTGSDFLWVKCLPCSSCQPVKGLTYFDLSKSTTFFPRPCTKDCQKCYGKKM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23945			Eukaryotic aspartyl protease f...		Lus10011611 [exp]	0	1

Compare expression of checked genes

Lus10011611 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.