Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30030 65 / 3e-13 Eukaryotic aspartyl protease family protein (.1) AT2G23945 64 / 6e-13 Eukaryotic aspartyl protease family protein (.1) AT4G30040 54 / 1e-09 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023451 [exp] 211 / 5e-68 AT2G23945 232 / 2e-71 Eukaryotic aspartyl protease family protein (.1) Lus10011615 [exp] 140 / 1e-40 AT2G23945 224 / 5e-68 Eukaryotic aspartyl protease family protein (.1) Lus10031449 [exp] 125 / 2e-35 AT2G23945 219 / 3e-66 Eukaryotic aspartyl protease family protein (.1) Lus10031450 [exp] 120 / 4e-33 AT4G30030 231 / 2e-71 Eukaryotic aspartyl protease family protein (.1) Lus10015486 [exp] 107 / 4e-28 AT2G23945 248 / 3e-76 Eukaryotic aspartyl protease family protein (.1) Lus10004064 [exp] 71 / 3e-15 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1) Lus10002276 [exp] 69 / 9e-15 AT2G23945 206 / 2e-61 Eukaryotic aspartyl protease family protein (.1) Lus10019960 [exp] 59 / 6e-11 AT2G23945 256 / 5e-81 Eukaryotic aspartyl protease family protein (.1) Lus10015487 [exp] 55 / 1e-09 AT2G23945 214 / 7e-65 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G179500 [exp] 62 / 2e-12 AT2G23945 412 / 3e-141 Eukaryotic aspartyl protease family protein (.1) Potri.018G106500 [exp] 58 / 7e-11 AT4G30030 150 / 2e-41 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011612 pacid=23150925 polypeptide=Lus10011612 locus=Lus10011612.g ID=Lus10011612.BGIv1.0 annot-version=v1.0 ATGCTGTTTTACCTCTATAGCGAAGCTTATGATGTGCTCAAGGCTGAGATCGATAAGACGGCTTCGAGGGTGATGCTGAAGGTTCCGTCGCCTGGGCCAC CGTACGAGCTGTGCTACAGAGGCCATGTGTACTCGGATCCTGTCGGGTTTCCGCTGCTGGAACTTCAATTTGTGTCGGGGGCAACCTTGGGAATGGAGCC GCGGGAGATCTTCACGCAGATCAACGACAACACATTTTGCATGGCTATTGTGAAGTCGGAGTCAGTTACCGTTATTGGGGTAATGGCTCAGCAAAAGTCG AATATTGGGAATGATTTAAGAAAAAGCTTATGTATTGAGAAGATTGAGGGTTTTACTATTATATAG
AA sequence Show only first row Show all	>Lus10011612 pacid=23150925 polypeptide=Lus10011612 locus=Lus10011612.g ID=Lus10011612.BGIv1.0 annot-version=v1.0 MLFYLYSEAYDVLKAEIDKTASRVMLKVPSPGPPYELCYRGHVYSDPVGFPLLELQFVSGATLGMEPREIFTQINDNTFCMAIVKSESVTVIGVMAQQKS NIGNDLRKSLCIEKIEGFTII

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30030			Eukaryotic aspartyl protease f...		Lus10011612 [exp]	0	1
					Lus10033149 [exp]	3.7	0.9333
					Lus10001119 [exp]	4.6	0.8119
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10023215 [exp]	5.3	0.9333
AT4G30720		PDE327	PIGMENT DEFECTIVE 327, FAD/NAD...		Lus10010777 [exp]	5.4	0.7446
AT3G14040			Pectin lyase-like superfamily ...		Lus10023364 [exp]	6.5	0.9333
AT3G16180			Major facilitator superfamily ...		Lus10009506 [exp]	7.5	0.9333
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10003281 [exp]	8.4	0.9333
AT1G29430			SAUR-like auxin-responsive pro...		Lus10020441 [exp]	9.2	0.9333
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10019334 [exp]	9.9	0.9333
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10027028 [exp]	10.6	0.9333

Compare expression of checked genes

Lus10011612 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.