Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011620 pacid=23150917 polypeptide=Lus10011620 locus=Lus10011620.g ID=Lus10011620.BGIv1.0 annot-version=v1.0 ATGTGCTTGAGGAGTTGGGTTAAGGATGAGATCGAGAAAGAATGTCCAAAGGATATTGCTGCACTACAAGGTTATTTCTCGGAGCTAAATTTGAAGGGAG CATTGGAGAATGAGGATGTGAACATTGATGAAGGTATGGACTATGGTGGAGTCAAGTGTTGGTTTATTAACTTCTTGGTTCTGTAA
AA sequence Show only first row Show all	>Lus10011620 pacid=23150917 polypeptide=Lus10011620 locus=Lus10011620.g ID=Lus10011620.BGIv1.0 annot-version=v1.0 MCLRSWVKDEIEKECPKDIAALQGYFSELNLKGALENEDVNIDEGMDYGGVKCWFINFLVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011620 [exp]	0	1
					Lus10027564 [exp]	2.0	0.7386
AT5G20140			SOUL heme-binding family prote...		Lus10035075 [exp]	7.7	0.6074
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013925 [exp]	19.0	0.6099
AT5G42170			SGNH hydrolase-type esterase s...		Lus10003720 [exp]	21.6	0.7055
AT4G02210			unknown protein		Lus10008312 [exp]	21.9	0.6326
					Lus10031558 [exp]	26.1	0.5969
AT5G17490	GRAS	AtRGL3, RGL3	RGA-like protein 3 (.1)		Lus10002424 [exp]	37.6	0.5880
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10032836 [exp]	38.4	0.5880
					Lus10005843 [exp]	39.2	0.5880
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10036381 [exp]	39.9	0.5880

Compare expression of checked genes

Lus10011620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.