Lus10011620 [FLAX]

| External link |
|
|||||
|---|---|---|---|---|---|---|
| Symbol | ||||||
|
Arabidopsis homologues
|
No hit found | |||||
|
Paralogs
|
|
|||||
|
Poplar homologues |
No hit found |
|||||
| PFAM info | ||||||
|
Representative CDS sequence |
>Lus10011620 pacid=23150917 polypeptide=Lus10011620 locus=Lus10011620.g ID=Lus10011620.BGIv1.0 annot-version=v1.0
ATGTGCTTGAGGAGTTGGGTTAAGGATGAGATCGAGAAAGAATGTCCAAAGGATATTGCTGCACTACAAGGTTATTTCTCGGAGCTAAATTTGAAGGGAG
CATTGGAGAATGAGGATGTGAACATTGATGAAGGTATGGACTATGGTGGAGTCAAGTGTTGGTTTATTAACTTCTTGGTTCTGTAA
|
|||||
|
AA sequence
|
>Lus10011620 pacid=23150917 polypeptide=Lus10011620 locus=Lus10011620.g ID=Lus10011620.BGIv1.0 annot-version=v1.0
MCLRSWVKDEIEKECPKDIAALQGYFSELNLKGALENEDVNIDEGMDYGGVKCWFINFLVL
|
DESeq2's median of ratios [FLAX]
Coexpressed genes
Lus10011620 coexpression network
*The number of genes in the network is adjusted within 50 genes.*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.