Lus10011621 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20480 156 / 8e-46 AMP-dependent synthetase and ligase family protein (.1)
AT1G20510 154 / 4e-45 OPCL1 OPC-8:0 CoA ligase1 (.1.2)
AT5G63380 147 / 3e-42 AMP-dependent synthetase and ligase family protein (.1)
AT1G20500 145 / 6e-42 AMP-dependent synthetase and ligase family protein (.1)
AT5G38120 137 / 4e-39 4CL8 AMP-dependent synthetase and ligase family protein (.1)
AT4G05160 135 / 4e-38 AMP-dependent synthetase and ligase family protein (.1)
AT4G19010 128 / 2e-35 AMP-dependent synthetase and ligase family protein (.1)
AT3G21230 120 / 1e-32 4CL5 4-coumarate:CoA ligase 5 (.1)
AT3G21240 114 / 2e-30 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1)
AT1G51680 110 / 5e-29 AT4CL1, 4CL.1, 4CL1 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038667 252 / 4e-82 AT1G20510 449 / 1e-152 OPC-8:0 CoA ligase1 (.1.2)
Lus10037934 233 / 5e-75 AT1G20510 462 / 2e-157 OPC-8:0 CoA ligase1 (.1.2)
Lus10012280 147 / 6e-42 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10036994 144 / 2e-41 AT5G63380 516 / 4e-179 AMP-dependent synthetase and ligase family protein (.1)
Lus10015998 142 / 2e-40 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10021431 142 / 2e-40 AT4G05160 803 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10002791 142 / 2e-40 AT5G63380 688 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10016135 137 / 9e-39 AT4G05160 791 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10015999 135 / 4e-38 AT1G20510 692 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G031500 165 / 4e-49 AT1G20510 466 / 3e-159 OPC-8:0 CoA ligase1 (.1.2)
Potri.010G230200 164 / 1e-48 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2)
Potri.002G012800 150 / 1e-43 AT1G20510 769 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.012G095000 149 / 4e-43 AT5G63380 615 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.012G094800 148 / 5e-43 AT5G63380 657 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.005G248500 147 / 2e-42 AT1G20510 795 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.015G092300 146 / 4e-42 AT5G63380 594 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.012G094900 144 / 2e-41 AT5G63380 604 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.004G102000 140 / 3e-40 AT4G05160 826 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.017G112800 140 / 3e-40 AT4G05160 852 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10011621 pacid=23150919 polypeptide=Lus10011621 locus=Lus10011621.g ID=Lus10011621.BGIv1.0 annot-version=v1.0
ATGGCGCCCTACGCACGTGGGGAGCTGTGGGTGAAGAGCCCGACGGTGATGAAGGGGTACCTGAGGAATGAGGAGGCGACGGCGGAAGCGGTTGATAAGG
AAGGGTGGTTGAGGACTGGGGATCAGTGTTATTTCGACGGAGAAGGGGTTTTTTATGTTGTTGATCGGATCAAGGAGCTGATCAAGCATAATGGGTATCA
GGTGGCCCCGGCGGAACTGGAAGCGATACTGTCAAGACTTCCTCAAGTAATGGACGCTGCAGTGATACCAGTTAAAGATGCGGCGTCGGGAGAAATACCA
ATGGCGTATGTTGTCGGAGCTTCCGGCGGTGAAGCAGGACTCACTGAACATCAACTCTGTTGGGGCGCTAGCGGAAATGTAGCGGAATTTAGGATCGAAA
AGATAGTATTTTGA
AA sequence
>Lus10011621 pacid=23150919 polypeptide=Lus10011621 locus=Lus10011621.g ID=Lus10011621.BGIv1.0 annot-version=v1.0
MAPYARGELWVKSPTVMKGYLRNEEATAEAVDKEGWLRTGDQCYFDGEGVFYVVDRIKELIKHNGYQVAPAELEAILSRLPQVMDAAVIPVKDAASGEIP
MAYVVGASGGEAGLTEHQLCWGASGNVAEFRIEKIVF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20480 AMP-dependent synthetase and l... Lus10011621 0 1
Lus10000363 2.2 1.0000
Lus10003285 3.9 1.0000
AT3G10340 PAL4 phenylalanine ammonia-lyase 4 ... Lus10001405 4.0 1.0000
Lus10004996 5.3 1.0000
Lus10025781 6.3 1.0000
AT4G22285 Ubiquitin C-terminal hydrolase... Lus10027745 6.9 1.0000
AT2G25737 Sulfite exporter TauE/SafE fam... Lus10022134 7.5 1.0000
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10006726 7.5 1.0000
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10015284 10.0 0.9536
AT5G12060 Plant self-incompatibility pro... Lus10022829 10.8 1.0000

Lus10011621 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.