Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11630 83 / 1e-22 unknown protein AT4G17310 56 / 5e-12 unknown protein AT5G47455 48 / 9e-09 unknown protein AT4G39300 41 / 3e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002035 [exp] 96 / 9e-28 AT5G11630 80 / 3e-21 unknown protein Lus10028954 [exp] 55 / 2e-11 AT4G17310 100 / 5e-29 unknown protein Lus10007477 [exp] 53 / 8e-11 AT4G17310 95 / 6e-27 unknown protein Lus10026596 [exp] 38 / 8e-05 AT2G15000 123 / 6e-38 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G237800 [exp] 86 / 8e-24 AT5G11630 99 / 8e-29 unknown protein Potri.017G068600 [exp] 56 / 7e-12 AT4G17310 94 / 2e-26 unknown protein Potri.001G333800 [exp] 48 / 8e-09 AT5G47455 54 / 1e-10 unknown protein Potri.002G045600 [exp] 42 / 1e-06 AT5G11630 69 / 5e-17 unknown protein Potri.004G154800 [exp] 39 / 3e-05 AT4G39300 97 / 1e-27 unknown protein Potri.009G115900 [exp] 37 / 0.0001 AT4G39300 114 / 1e-34 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011623 pacid=23150915 polypeptide=Lus10011623 locus=Lus10011623.g ID=Lus10011623.BGIv1.0 annot-version=v1.0 ATGGTTGTTACGGCTCACTATATCGACAACTCTTGGGTGCTTAAGAGTCACATGCTTAGGCCGGTTGCTCAACTGGGAGCTCTACAATCGCTTTTCCCGC TTCACTCTGCGGTCTCCTCAGCTCGCCTCACATCCTGCCTCGGCGCTGATACCAGCAGCACCAGGTCGTTGTCTCAGGGTATGCTCTGCAGTGCCAACCC AGGAGTTTGA
AA sequence Show only first row Show all	>Lus10011623 pacid=23150915 polypeptide=Lus10011623 locus=Lus10011623.g ID=Lus10011623.BGIv1.0 annot-version=v1.0 MVVTAHYIDNSWVLKSHMLRPVAQLGALQSLFPLHSAVSSARLTSCLGADTSSTRSLSQGMLCSANPGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G11630			unknown protein		Lus10011623 [exp]	0	1
AT5G25310			Exostosin family protein (.1)		Lus10001917 [exp]	4.6	0.6851
AT3G20050		ATTCP-1	T-complex protein 1 alpha subu...		Lus10036713 [exp]	7.2	0.6948
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015864 [exp]	8.3	0.7264
AT3G03250		AtUGP1, UGP1, U...	UDP-GLUCOSE PYROPHOSPHORYLASE ...		Lus10031368 [exp]	26.8	0.6312
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10029658 [exp]	26.9	0.6460
AT1G69290			Pentatricopeptide repeat (PPR)...		Lus10036907 [exp]	43.5	0.6659
AT5G40480		EMB3012	embryo defective 3012 (.1)		Lus10002516 [exp]	65.0	0.6366
AT3G23750			Leucine-rich repeat protein ki...		Lus10023220 [exp]	73.2	0.6242
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004068 [exp]	134.4	0.5418
AT1G17930			Aminotransferase-like, plant m...		Lus10011644 [exp]	169.0	0.5520

Compare expression of checked genes

Lus10011623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.