Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79470 42 / 9e-06 Aldolase-type TIM barrel family protein (.1) AT1G16350 39 / 0.0002 Aldolase-type TIM barrel family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001763 [exp] 91 / 9e-23 AT1G54310 653 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Lus10036443 [exp] 81 / 2e-20 AT1G16350 113 / 1e-29 Aldolase-type TIM barrel family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G082800 [exp] 58 / 2e-11 AT1G16350 717 / 0.0 Aldolase-type TIM barrel family protein (.1) Potri.010G173600 [exp] 50 / 1e-08 AT1G16350 661 / 0.0 Aldolase-type TIM barrel family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011631 pacid=23172905 polypeptide=Lus10011631 locus=Lus10011631.g ID=Lus10011631.BGIv1.0 annot-version=v1.0 ATGGACACCGTCACCAAGTCCGACATGGCCGCACTTGGCGGTATCGCAATCGTCCGCTACAACACCACTCCTTTCACCCAAGCCTCCTTCGTCAGATCCG TGAAATCCCGCGGTGTACCTTTGGTATTTAGTTTGAGTGTGTTCTCCCCTGACTCTCGGACCAAGGAGAATGATTTGAAATTGGTCGATTACATGATTTC CGCTGATTCGTCCCTTCTAGTTTCATCTAGCTACGATATGGATAAGCTCGATTCCCACCTCCAACACATGGTTCAATAA
AA sequence Show only first row Show all	>Lus10011631 pacid=23172905 polypeptide=Lus10011631 locus=Lus10011631.g ID=Lus10011631.BGIv1.0 annot-version=v1.0 MDTVTKSDMAALGGIAIVRYNTTPFTQASFVRSVKSRGVPLVFSLSVFSPDSRTKENDLKLVDYMISADSSLLVSSSYDMDKLDSHLQHMVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011631 [exp]	0	1
					Lus10014031 [exp]	1.4	0.9069
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028942 [exp]	2.0	0.9125
AT2G38940		PHT1;4, ATPT2	ARABIDOPSIS THALIANA PHOSPHATE...		Lus10033866 [exp]	2.8	0.8972
AT3G42150			unknown protein		Lus10031451 [exp]	3.7	0.8489
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	4.2	0.9019
AT2G36960	MYB	TKI1	TSL-kinase interacting protein...		Lus10010230 [exp]	6.9	0.8725
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10039772 [exp]	8.4	0.7540
AT1G22540			Major facilitator superfamily ...		Lus10001287 [exp]	8.5	0.8469
AT4G03230			S-locus lectin protein kinase ...		Lus10033752 [exp]	14.4	0.8050
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	15.3	0.8737

Compare expression of checked genes

Lus10011631 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.