Lus10011640 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56450 427 / 8e-154 PBG1 20S proteasome beta subunit G1 (.1)
AT5G40580 43 / 7e-05 PBB2 20S proteasome beta subunit PBB2 (.1.2.3)
AT3G27430 43 / 8e-05 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT4G14800 41 / 0.0003 PBD2 20S proteasome beta subunit D2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036124 504 / 0 AT1G56450 426 / 4e-153 20S proteasome beta subunit G1 (.1)
Lus10032102 46 / 1e-05 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10014581 45 / 3e-05 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3)
Lus10041194 40 / 0.001 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1)
Lus10021909 40 / 0.001 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G037700 430 / 6e-155 AT1G56450 407 / 5e-146 20S proteasome beta subunit G1 (.1)
Potri.006G242000 424 / 1e-152 AT1G56450 399 / 1e-142 20S proteasome beta subunit G1 (.1)
Potri.006G077900 51 / 2e-07 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.010G084800 45 / 1e-05 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1)
Potri.004G066000 45 / 2e-05 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.017G071100 45 / 2e-05 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3)
Potri.008G155500 44 / 3e-05 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Lus10011640 pacid=23172916 polypeptide=Lus10011640 locus=Lus10011640.g ID=Lus10011640.BGIv1.0 annot-version=v1.0
ATGGAATCGAATCAAACTAAGCCGAGCCTTCTGGCTTCTGAATCTGAGTCCCAGCGAACGCTATATCCGTATGTGACTGGTACTTCTGTGGTGGCTTTGA
AGTACAAGGACGGGATTTTGATGGCTGCTGACATGGGAGGTTCATATGGGTCGACCTTGCGATACAAGAGTGTGGGTCGAATGACGCCTGTTGGCAAGCA
CTCTTTGCTTGGCGCAAGTGGGGAAATCAGCGATTTCCAGGAGATATGCCGGTATCTTGATCAGCTGGTCCTAAATGACAACATGTGGGATGATGGGAAC
TCTTTGGGTCCAAAGGAAGTGCACAACTATTTGACTAGAGTTATGTACAATAGGAGGAACAAGTTTGATCCTTTTTGGAATGCGCTTGTTCTTGGTGGAG
TTAAAAATGGTCAGAAGTATCTCGGCATGGTAAACATGATTGGTCTTAATTTTGAGGATGATCATGTTGCGACTGGATTCGGAAATCACCTTGCTCGGCC
AATCCTTCGTGACGAGTGGCATGAAAACCTGAGCTTTGAAGATGGTGTTAAGTTGCTGGAGAAATGTATGCGTGTGCTCTTGTACCGTGACAGATCTGCT
GTCAATAAGCTTCAGATAGCTAAGATAACGGAAGAAGGTGTGACAATTTCACAGCCCTACTCGTTGAAGACTTTCTGGGGATACGCAGCATTCCAGAATC
CAACTGCAGGTGCGGAGGGATCATGGTAG
AA sequence
>Lus10011640 pacid=23172916 polypeptide=Lus10011640 locus=Lus10011640.g ID=Lus10011640.BGIv1.0 annot-version=v1.0
MESNQTKPSLLASESESQRTLYPYVTGTSVVALKYKDGILMAADMGGSYGSTLRYKSVGRMTPVGKHSLLGASGEISDFQEICRYLDQLVLNDNMWDDGN
SLGPKEVHNYLTRVMYNRRNKFDPFWNALVLGGVKNGQKYLGMVNMIGLNFEDDHVATGFGNHLARPILRDEWHENLSFEDGVKLLEKCMRVLLYRDRSA
VNKLQIAKITEEGVTISQPYSLKTFWGYAAFQNPTAGAEGSW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10011640 0 1
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10020599 6.2 0.7832
AT3G62810 complex 1 family protein / LVR... Lus10040570 6.3 0.7530
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10036124 14.9 0.8142
AT1G26690 emp24/gp25L/p24 family/GOLD fa... Lus10036786 16.2 0.7717
AT3G58730 vacuolar ATP synthase subunit ... Lus10027271 17.5 0.7092
AT1G07410 ATRAB-A2B, AtRA... ARABIDOPSIS RAB GTPASE HOMOLOG... Lus10016486 22.6 0.7392
AT4G35690 Arabidopsis protein of unknown... Lus10041834 25.1 0.6879
AT1G65290 MTACP2 mitochondrial acyl carrier pro... Lus10020221 25.8 0.7320
AT2G17390 AKR2B ankyrin repeat-containing 2B (... Lus10013859 29.8 0.7022
AT2G18110 Translation elongation factor... Lus10017261 34.8 0.6933

Lus10011640 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.