Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17930 47 / 2e-07 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000980 [exp] 143 / 2e-45 AT1G17930 56 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10000686 [exp] 134 / 3e-41 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1) Lus10012087 [exp] 132 / 5e-40 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020970 [exp] 136 / 9e-40 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1) Lus10024265 [exp] 132 / 9e-40 AT1G17930 59 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10001981 [exp] 126 / 2e-37 AT1G17930 61 / 2e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10027047 [exp] 130 / 6e-37 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1) Lus10043081 [exp] 120 / 2e-36 AT1G17930 64 / 2e-12 Aminotransferase-like, plant mobile domain family protein (.1) Lus10038548 [exp] 106 / 3e-30 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10011644 pacid=23172907 polypeptide=Lus10011644 locus=Lus10011644.g ID=Lus10011644.BGIv1.0 annot-version=v1.0 ATGGCAGGTTGTATTACTTTGTTCCAGTCCTTGGTTTATGAGCACTTTCCTAGTGTTAGGCCTGCTAGGATGGTGCGACAGGAGCGTAGAGCGGGTAAGG AGTTAGCTGGTAGATGGGACAGTGTCGAGATGCCTAGGAGGACTAGCGACGCCCTACGTGAGAGGCTGGACTACTACCATTGCCTCCTTGATGACATGGA TGCTCGTGACGTGACTTGGCTTCCGTTTGGTCCCGAACCCGACGTCGAGGTTCCTGAGTCGACTTTCCTTTGA
AA sequence Show only first row Show all	>Lus10011644 pacid=23172907 polypeptide=Lus10011644 locus=Lus10011644.g ID=Lus10011644.BGIv1.0 annot-version=v1.0 MAGCITLFQSLVYEHFPSVRPARMVRQERRAGKELAGRWDSVEMPRRTSDALRERLDYYHCLLDDMDARDVTWLPFGPEPDVEVPESTFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17930			Aminotransferase-like, plant m...		Lus10011644 [exp]	0	1
AT2G06090			Plant self-incompatibility pro...		Lus10011896 [exp]	3.3	0.9790
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004857 [exp]	4.1	0.8950
					Lus10006529 [exp]	4.7	0.9790
AT3G52490			Double Clp-N motif-containing ...		Lus10024536 [exp]	5.7	0.9790
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10040526 [exp]	6.2	0.9355
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015614 [exp]	6.6	0.9790
					Lus10035557 [exp]	7.4	0.9790
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10017625 [exp]	7.9	0.8790
AT5G53910			RING/U-box superfamily protein...		Lus10011380 [exp]	8.1	0.9790
AT1G01420		UGT72B3	UDP-glucosyl transferase 72B3 ...		Lus10001905 [exp]	8.7	0.8980

Compare expression of checked genes

Lus10011644 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.