Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01021 37 / 5e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011647 pacid=23172909 polypeptide=Lus10011647 locus=Lus10011647.g ID=Lus10011647.BGIv1.0 annot-version=v1.0 ATGGGGAGCCCGCAGGCCGACGCCCTAATCGCACAGGTGCGTGAGAACACTGTGATGGCACGTGCTGCAGTCCAGAATCGCGGCGGCGGTATGTCTACAA GCTTTTCAAAGGAAAGGGCTTGGGTAGCAACCGCACTCCGCGTCAGTCCGCACCCCGAGCCGATACGCGGACCGGCACTAGCCGTTCCGCATCCGATTGG GGTGCATTGCCAACCCCCATCTGCATCCCTCCCTGCAATTTAG
AA sequence Show only first row Show all	>Lus10011647 pacid=23172909 polypeptide=Lus10011647 locus=Lus10011647.g ID=Lus10011647.BGIv1.0 annot-version=v1.0 MGSPQADALIAQVRENTVMARAAVQNRGGGMSTSFSKERAWVATALRVSPHPEPIRGPALAVPHPIGVHCQPPSASLPAI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011647 [exp]	0	1
AT2G42430	AS2	ASL18, LBD16	ASYMMETRIC LEAVES2-LIKE 18, la...		Lus10014757 [exp]	4.1	0.7169
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10024197 [exp]	22.3	0.6813
					Lus10000299 [exp]	32.0	0.6472
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023456 [exp]	41.8	0.6152
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Lus10009746 [exp]	47.6	0.5459
AT1G11340			S-locus lectin protein kinase ...		Lus10002717 [exp]	69.3	0.6031
AT5G38460			ALG6, ALG8 glycosyltransferase...		Lus10033554 [exp]	82.6	0.5326
AT5G01150			Protein of unknown function (D...		Lus10002340 [exp]	148.7	0.5141
AT4G27410	NAC	RD26, ANAC072	NAC (No Apical Meristem) domai...		Lus10003458 [exp]	163.3	0.5178

Compare expression of checked genes

Lus10011647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.