Lus10011651 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49055 47 / 9e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021563 72 / 6e-19 AT3G49055 55 / 1e-10 unknown protein
Lus10027489 64 / 7e-14 AT3G49055 244 / 3e-75 unknown protein
Lus10039244 39 / 6e-05 AT3G49055 89 / 2e-21 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G146100 45 / 4e-07 AT3G49055 191 / 1e-54 unknown protein
PFAM info
Representative CDS sequence
>Lus10011651 pacid=23149667 polypeptide=Lus10011651 locus=Lus10011651.g ID=Lus10011651.BGIv1.0 annot-version=v1.0
ATGATTTATTTCAGTTCCCTTTCAGGTCCAGGCTTCAACCTCACTTTGGTGGAGGAGCTTACAGCAAAGAACAAAGAAGCAGAGGTAGAAGCAAGAAGGT
GGATGGAAGCTTGCGAGTTAGAAGTGGAAGTTGGGAAGCAAGAGGTTGCAGAACGGGACAAAATGGTGAACTATAGCTCTTCTTCTTGA
AA sequence
>Lus10011651 pacid=23149667 polypeptide=Lus10011651 locus=Lus10011651.g ID=Lus10011651.BGIv1.0 annot-version=v1.0
MIYFSSLSGPGFNLTLVEELTAKNKEAEVEARRWMEACELEVEVGKQEVAERDKMVNYSSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49055 unknown protein Lus10011651 0 1
Lus10001326 3.0 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 4.2 1.0000
Lus10026755 5.5 1.0000
AT2G19110 ATHMA4, HMA4 ARABIDOPSIS HEAVY METAL ATPASE... Lus10006956 5.9 1.0000
AT4G17260 Lactate/malate dehydrogenase f... Lus10028931 6.6 1.0000
Lus10016593 7.5 1.0000
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10008511 7.7 1.0000
AT5G13620 unknown protein Lus10017168 8.0 1.0000
Lus10043174 8.4 1.0000
AT2G43610 Chitinase family protein (.1) Lus10020253 9.5 1.0000

Lus10011651 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.