Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49055 47 / 9e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021563 [exp] 72 / 6e-19 AT3G49055 55 / 1e-10 unknown protein Lus10027489 [exp] 64 / 7e-14 AT3G49055 244 / 3e-75 unknown protein Lus10039244 [exp] 39 / 6e-05 AT3G49055 89 / 2e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G146100 [exp] 45 / 4e-07 AT3G49055 191 / 1e-54 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011651 pacid=23149667 polypeptide=Lus10011651 locus=Lus10011651.g ID=Lus10011651.BGIv1.0 annot-version=v1.0 ATGATTTATTTCAGTTCCCTTTCAGGTCCAGGCTTCAACCTCACTTTGGTGGAGGAGCTTACAGCAAAGAACAAAGAAGCAGAGGTAGAAGCAAGAAGGT GGATGGAAGCTTGCGAGTTAGAAGTGGAAGTTGGGAAGCAAGAGGTTGCAGAACGGGACAAAATGGTGAACTATAGCTCTTCTTCTTGA
AA sequence Show only first row Show all	>Lus10011651 pacid=23149667 polypeptide=Lus10011651 locus=Lus10011651.g ID=Lus10011651.BGIv1.0 annot-version=v1.0 MIYFSSLSGPGFNLTLVEELTAKNKEAEVEARRWMEACELEVEVGKQEVAERDKMVNYSSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49055			unknown protein		Lus10011651 [exp]	0	1
					Lus10001326 [exp]	3.0	1.0000
AT5G35750		AHK2	histidine kinase 2 (.1)		Lus10009736 [exp]	4.2	1.0000
					Lus10026755 [exp]	5.5	1.0000
AT2G19110		ATHMA4, HMA4	ARABIDOPSIS HEAVY METAL ATPASE...		Lus10006956 [exp]	5.9	1.0000
AT4G17260			Lactate/malate dehydrogenase f...		Lus10028931 [exp]	6.6	1.0000
					Lus10016593 [exp]	7.5	1.0000
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10008511 [exp]	7.7	1.0000
AT5G13620			unknown protein		Lus10017168 [exp]	8.0	1.0000
					Lus10043174 [exp]	8.4	1.0000
AT2G43610			Chitinase family protein (.1)		Lus10020253 [exp]	9.5	1.0000

Compare expression of checked genes

Lus10011651 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.