Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032742 [exp] 179 / 3e-60 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G130500 [exp] 78 / 3e-20 AT5G66985 / unknown protein Potri.014G038500 [exp] 77 / 5e-20 ND / Potri.007G034700 [exp] 54 / 6e-11 AT5G66985 43 / 1e-06 unknown protein Potri.005G131000 [exp] 52 / 8e-10 AT5G66985 43 / 2e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10011653 pacid=23149661 polypeptide=Lus10011653 locus=Lus10011653.g ID=Lus10011653.BGIv1.0 annot-version=v1.0 ATGTCTTCTACGGTGGCCAGAAACCAGCAACCCACTCGTTCGGCGGAGAGTATTCCGGAGGATCAGGAAGAAGTAGGGGAAGACGTTATGCCTAGCGCCG TCAGCAGCCAGGTGTACCTGAAGCCCGGAACCCTGGACAAAGAGGTGGTGCTGAGGCGGATCCGGCAGAGGAAGCGGATGAACAAGGTTACCGGAGCCAT CCAAGGTCTGTTCGGGTTCCGAGCCGCTGGGAAATCCAACAACGACGACGGAAAATCCGTTTCCGTTAAGTGGGTGGATGATGCCTTTGCTGCCCCCTAA
AA sequence Show only first row Show all	>Lus10011653 pacid=23149661 polypeptide=Lus10011653 locus=Lus10011653.g ID=Lus10011653.BGIv1.0 annot-version=v1.0 MSSTVARNQQPTRSAESIPEDQEEVGEDVMPSAVSSQVYLKPGTLDKEVVLRRIRQRKRMNKVTGAIQGLFGFRAAGKSNNDDGKSVSVKWVDDAFAAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10011653 [exp]	0	1
					Lus10032742 [exp]	1.0	0.9893
AT3G50845			Protein of unknown function (D...		Lus10026019 [exp]	2.4	0.9686
AT1G76360			Protein kinase superfamily pro...		Lus10012256 [exp]	5.0	0.9560
AT1G72360	AP2_ERF	AtERF73, HRE1	HYPOXIA RESPONSIVE ERF \(ETHYL...		Lus10008214 [exp]	7.7	0.9721
AT4G08320		TPR8	tetratricopeptide repeat 8, Te...		Lus10025656 [exp]	8.7	0.9578
AT3G14880			unknown protein		Lus10042453 [exp]	9.9	0.9637
AT3G50390			Transducin/WD40 repeat-like su...		Lus10016779 [exp]	10.2	0.9667
AT3G48660			Protein of unknown function (D...		Lus10003120 [exp]	10.5	0.9657
AT2G03340	WRKY	WRKY3	WRKY DNA-binding protein 3 (.1...		Lus10000173 [exp]	10.7	0.9652
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004858 [exp]	11.2	0.9580

Compare expression of checked genes

Lus10011653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.