Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26500 94 / 7e-26 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G108700 [exp] 82 / 2e-21 AT2G26500 95 / 2e-26 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3) Potri.014G037000 [exp] 76 / 1e-18 AT2G26500 79 / 1e-19 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3) Potri.004G147300 [exp] 74 / 7e-18 AT2G26500 54 / 3e-10 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3) Potri.002G130000 [exp] 0 / 1 AT2G26500 73 / 2e-17 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08041 [flax] [poplar] PetM PetM family of cytochrome b6f complex subunit 7
Representative CDS sequence Show only first row Show all	>Lus10011665 pacid=23149662 polypeptide=Lus10011665 locus=Lus10011665.g ID=Lus10011665.BGIv1.0 annot-version=v1.0 ATGGCAACAGCAGCAGCTCCATCATCAACTGTAACTCGCGCAGCGTTAACCATTAGGAACTCTGCCACCGCCACCACCCAGAAGAGAAGTGGCCCCAAAG TTGTTTCCATTGGTGGTCTCAACAGCTCCTACCAAAGGCTTTCATCTGGTCCGGTTTGTGGTGATCAGGGCTATGTGAATGTTGTATACACCTCGCGTAG AGGTCGAAAAGGGATAAGTGGTGGTGGCAGTGGCCTCTCTGCCAAGTGCAGTAGAGTTGGGGAGATCTTCCAGATCGCTGCAATTATGAACGCCCTTACT TTGGTTGGTGTTGCAATTGGGTTTGTGCTTCTTCGAATTGAAGCTTCTGTTGAGGAAGCTGAGTGA
AA sequence Show only first row Show all	>Lus10011665 pacid=23149662 polypeptide=Lus10011665 locus=Lus10011665.g ID=Lus10011665.BGIv1.0 annot-version=v1.0 MATAAAPSSTVTRAALTIRNSATATTQKRSGPKVVSIGGLNSSYQRLSSGPVCGDQGYVNVVYTSRRGRKGISGGGSGLSAKCSRVGEIFQIAAIMNALT LVGVAIGFVLLRIEASVEEAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26500			cytochrome b6f complex subunit...		Lus10011665 [exp]	0	1
					Lus10018772 [exp]	1.0	0.9750
AT1G32470			Single hybrid motif superfamil...		Lus10035374 [exp]	2.0	0.9594
AT1G32470			Single hybrid motif superfamil...		Lus10030979 [exp]	2.4	0.9585
AT1G07700			Thioredoxin superfamily protei...		Lus10024726 [exp]	3.5	0.9568
AT1G54500			Rubredoxin-like superfamily pr...		Lus10019005 [exp]	4.9	0.9556
AT1G08380		PSAO	photosystem I subunit O (.1)		Lus10005199 [exp]	5.0	0.9560
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	5.9	0.9504
AT2G30570		PSBW	photosystem II reaction center...		Lus10018771 [exp]	6.0	0.9385
AT1G54500			Rubredoxin-like superfamily pr...		Lus10015945 [exp]	7.3	0.9468
AT4G23890		NdhS, CRR31	NADH dehydrogenase-like comple...		Lus10001826 [exp]	8.1	0.9427

Compare expression of checked genes

Lus10011665 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.