Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30440 174 / 1e-54 Plsp2B, TPP plastidic type I signal peptidase 2B, thylakoid processing peptide (.1) AT1G06870 164 / 1e-50 Plsp2A plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) AT3G24590 152 / 6e-47 PLSP1 plastidic type i signal peptidase 1 (.1) AT3G08980 51 / 6e-09 Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G23465 50 / 2e-08 Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G29960 50 / 3e-08 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G53530 47 / 1e-07 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032753 [exp] 235 / 3e-74 AT1G06870 379 / 3e-125 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10023651 [exp] 142 / 6e-43 AT3G24590 318 / 2e-109 plastidic type i signal peptidase 1 (.1) Lus10034925 [exp] 140 / 4e-42 AT3G24590 316 / 1e-108 plastidic type i signal peptidase 1 (.1) Lus10002492 [exp] 49 / 5e-08 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10004822 [exp] 47 / 3e-07 AT3G08980 190 / 9e-63 Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10025393 [exp] 42 / 3e-05 AT1G53530 169 / 3e-54 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10005571 [exp] 40 / 0.0001 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10013703 [exp] 39 / 0.0007 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G036400 [exp] 201 / 5e-65 AT1G06870 377 / 8e-130 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) Potri.018G081800 [exp] 149 / 3e-45 AT3G24590 372 / 3e-130 plastidic type i signal peptidase 1 (.1) Potri.006G157900 [exp] 147 / 3e-44 AT3G24590 357 / 5e-124 plastidic type i signal peptidase 1 (.1) Potri.002G079600 [exp] 120 / 4e-35 AT3G24590 177 / 3e-55 plastidic type i signal peptidase 1 (.1) Potri.005G092900 [exp] 49 / 8e-08 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Potri.001G380400 [exp] 48 / 1e-07 AT1G53530 227 / 3e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Potri.016G115100 [exp] 47 / 3e-07 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1) Potri.007G071400 [exp] 41 / 4e-05 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0299 [flax] [poplar] Peptidase_SF PF10502 [flax] [poplar] Peptidase_S26 Signal peptidase, peptidase S26
Representative CDS sequence Show only first row Show all	>Lus10011671 pacid=23149645 polypeptide=Lus10011671 locus=Lus10011671.g ID=Lus10011671.BGIv1.0 annot-version=v1.0 ATGCAGGAATATGGTTTCAGGTCAGGAGATGTGTTCATCAAGAGAGTAGTGGCAAAGGCTGGAGACATTGTTGAAGTCCGTGAGGGAAAATTATATGTCA ATGGGGTTGCTGAAGATGAAGAGTTTGTTATGGAGCCACTTGCTTATGAAATGGAACCTATGGTTGTGCCAGAAGGCTATGTTTTTGTGTTGGGGGACAA TCGGAACAATAGCTTTGATTCTCACAACTGGGGTCCACTTCCTATCCAGAACGTTGTGGGTAGATCTGTGTTCCGCTACTGGCCTCCTGCCAAAGTCTCC AATATGATTTATGGTCCCCATGTTGAGAAGAGTGCTGAACACCATGGCGTCGTTGGTGCTGCTTGTGCTGCAAATTCTTGA
AA sequence Show only first row Show all	>Lus10011671 pacid=23149645 polypeptide=Lus10011671 locus=Lus10011671.g ID=Lus10011671.BGIv1.0 annot-version=v1.0 MQEYGFRSGDVFIKRVVAKAGDIVEVREGKLYVNGVAEDEEFVMEPLAYEMEPMVVPEGYVFVLGDNRNNSFDSHNWGPLPIQNVVGRSVFRYWPPAKVS NMIYGPHVEKSAEHHGVVGAACAANS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30440		Plsp2B, TPP	plastidic type I signal peptid...		Lus10011671 [exp]	0	1
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10021561 [exp]	1.0	0.8861
AT1G06870		Plsp2A	plastidic type I signal peptid...		Lus10032753 [exp]	2.0	0.8708
AT3G12360		ITN1	INCREASED TOLERANCE TO NACL, A...		Lus10003308 [exp]	2.2	0.8596
AT4G25150			HAD superfamily, subfamily III...		Lus10013478 [exp]	5.3	0.8191
AT3G66654			Cyclophilin-like peptidyl-prol...		Lus10021052 [exp]	5.5	0.8410
AT5G58430		ATEXO70B1	exocyst subunit exo70 family p...		Lus10011861 [exp]	6.2	0.8418
AT1G49050			Eukaryotic aspartyl protease f...		Lus10032485 [exp]	7.1	0.8474
AT1G49050			Eukaryotic aspartyl protease f...		Lus10042982 [exp]	7.9	0.8662
AT5G53130		ATCNGC1, CNGC1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10014925 [exp]	13.5	0.8536
AT2G19830		VPS32, SNF7.2	SNF7 family protein (.1)		Lus10032705 [exp]	14.1	0.8569

Compare expression of checked genes

Lus10011671 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.