Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24570 231 / 3e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT5G43140 78 / 2e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT2G14860 74 / 5e-16 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G14305 71 / 2e-15 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT5G19750 71 / 9e-15 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G33905 70 / 2e-14 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G04470 66 / 2e-13 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G03410 60 / 7e-11 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT1G52870 55 / 4e-09 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022130 [exp] 351 / 5e-125 AT3G24570 256 / 6e-87 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10038626 [exp] 278 / 8e-96 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10037900 [exp] 247 / 3e-83 AT3G24570 246 / 3e-82 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10034922 [exp] 232 / 7e-78 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10023648 [exp] 232 / 1e-77 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10011798 [exp] 71 / 2e-15 AT4G14305 262 / 1e-90 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10011424 [exp] 71 / 2e-14 AT2G14860 288 / 3e-98 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10018700 [exp] 71 / 2e-14 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10002118 [exp] 69 / 5e-14 AT2G14860 292 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G037100 [exp] 266 / 2e-91 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.018G081600 [exp] 240 / 4e-81 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.006G242700 [exp] 184 / 1e-59 AT3G24570 214 / 4e-71 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.001G296400 [exp] 72 / 3e-15 AT2G14860 300 / 6e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.009G090600 [exp] 70 / 1e-14 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.011G007100 [exp] 69 / 1e-14 AT4G04470 230 / 1e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.016G029700 [exp] 68 / 1e-13 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.006G032500 [exp] 67 / 2e-13 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.004G008700 [exp] 65 / 3e-13 AT4G04470 209 / 2e-69 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.001G404600 [exp] 54 / 1e-08 AT1G52870 438 / 6e-154 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04117 [flax] [poplar] Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence Show only first row Show all	>Lus10011679 pacid=23156334 polypeptide=Lus10011679 locus=Lus10011679.g ID=Lus10011679.BGIv1.0 annot-version=v1.0 ATGCTGAAGTTAGGGAAGTGGTTCGAGCGGTGTATGGCGGTGCATCCGGTGAAAACGCAGATGATTAGCTCTGCTTTGATATGGGGTGTTGGTGACTTTG CTGCTCAGTCCATCACCCATTATGGTGATCAAGTAGTTGACTGGAAAAGAGTGGCAACCATGAGCTTGTTTGGATTCGGATTCGTCGGACCAGTTGGCCA TTACTGGTACGAAGGTCTAGACAAATTCATAAGGTCAAAGTTCTCCCGAGCCAATTCATTGAGGTTTGTTGGTGCTAAAGTGGTGATCGACAGTCTGTTG CTAGGGCCATTGGATCTACTGTTGTTCTTCAGTTACATGGGGTTTGCTACTGGGAAGAGCATGTCACAAATAAAGGGTGACGTGAAGAGAGATTTCGTAC CGGCTTTGGTGATGGAAGGTCTGTGGCCACTTGTTCAATCAGCCAACTTCCGATTCGTGCCGGTGAAATATCAGCTTCTGTATGTCAATGTCTTCTGCTT GTTGGATAGTTGCTTCCTTTCCTGGGTTGAGCAGCAGCACGGTGCTCCTTGGAAGACATGGGTCAACTCTTTCTTGCCTTACCAAGTCCCAAAGTGA
AA sequence Show only first row Show all	>Lus10011679 pacid=23156334 polypeptide=Lus10011679 locus=Lus10011679.g ID=Lus10011679.BGIv1.0 annot-version=v1.0 MLKLGKWFERCMAVHPVKTQMISSALIWGVGDFAAQSITHYGDQVVDWKRVATMSLFGFGFVGPVGHYWYEGLDKFIRSKFSRANSLRFVGAKVVIDSLL LGPLDLLLFFSYMGFATGKSMSQIKGDVKRDFVPALVMEGLWPLVQSANFRFVPVKYQLLYVNVFCLLDSCFLSWVEQQHGAPWKTWVNSFLPYQVPK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24570			Peroxisomal membrane 22 kDa (M...		Lus10011679 [exp]	0	1
AT2G40370		LAC5	laccase 5 (.1)		Lus10007531 [exp]	1.4	0.9827
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Lus10041142 [exp]	1.4	0.9853
AT3G11780			MD-2-related lipid recognition...		Lus10021256 [exp]	2.0	0.9754
AT5G10280	MYB	ATMYB92, AtMYB6...	myb domain protein 92 (.1)		Lus10036472 [exp]	2.4	0.9757
AT1G16060	AP2_ERF	ADAP	ARIA-interacting double AP2 do...		Lus10001553 [exp]	3.0	0.9533
AT5G44550			Uncharacterised protein family...		Lus10000781 [exp]	3.9	0.9601
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Lus10038937 [exp]	4.2	0.9582
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Lus10027227 [exp]	4.6	0.9550
AT1G20160		ATSBT5.2	Subtilisin-like serine endopep...		Lus10032096 [exp]	5.7	0.9545
AT3G45850			P-loop containing nucleoside t...		Lus10009073 [exp]	6.2	0.9414

Compare expression of checked genes

Lus10011679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.